Help  Custom Search
 
DnaJ homolog subfamily B member 8 of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily B member 8

Synonymous Names

DNJB8_HUMAN, Hsp40/J-protein, DNAJB8

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGC DSWRAGGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGLRGAFSAGFGE FPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFKSVMSSTEMINGHKVTTKRIVENGQERVEVE EDGQLKSVTVNGKEQLKWMDSK

FASTA Format Composition Secondary Structure

Nucleotide
 ACACCGCCTTTGCCATCACCACCGTCATTGCCCCCTCTACTACCACCACCATCACCACCACCGGGTCTGCCTCAGCCAGACCCACCACT
GCCTCTAATTAGACTGCCACCATCATCACTGCCACCACCACTGCCCCTCCAATGCCTTCCTGATGTCACCATCTGCTTTCTCTCTGCTAT
CCTCACACCCAACTCCATCAAAACCACCACCTTCATCTGAGCCGCCATCACCCTCACAGTACACAGCCCTCAAATGTGTACCAAGGAGGA
GGACATTTACTACACGCTGCACCCTGAACAGTCTGGGACCAGCGGTCAGGGAACAAGGAATCGAGATGCTCACCTGCAGCTCCCAGGTGA
GCGGCTCTCTAGAGCTTGCCTGGGAGCTGCTGAGGAGCTCACGGTATTCCAGGAAGCTCCCCATCCATGCCTCAGCCTGTGGCTCAGAAG
CAGGGTCTTCGCAGAAGATTGCCCCGAGCTGTTGCAAAGCTCACCATTGTCACCTGCCTGCAACGGCCTCTCTTTTCCACTCTCCAAATC
CCTTGTATTGGCAGGCTCTAGTCTGGAATTATACCGGTGATGGGATTCTGGAAAATCCCTCAGATTTCTCCAGGATGCAAGGAGACCATG
GAAGAGGAACAAGCCTGCAAGGGACAGCAGGTGCTAACTGCTAACCGAGACATAGTGACAAAAATCCAGCCACAGAGATAAAGAATCAGG
TTCATCTGTAGCTACATCCAGTGGAGAAGTTCTGCTCTTCAACTCCTCTGCTAAGCCACATGTGTCAGCAGGTGTAGAATTGAGTGGAAC
ACTTCTTTGGATTTGCTGTCCGCTGCAGCCTTGGCCCTGGTTTCACATCCCCTCCCTCACTGACTCGCTGTGTGACCTTGAGCACTGTGT
GTCTCTGAGCCTGGTTCATCCAAGAGTTTACCGACGGCCCTCGTGTGCCAGCCACTGTCCTAGACAGGGACAGACTTTCCCGCCTTTGTG
GAGCTTACCCCGGAAGACCTGGCCAGATAATGGGCACAAAAAAAGCAGGCTCTTGTCCCCACCCCAGCCTGCCTGAACCCCACCTTGGCC
TCCTCTTGCCTCAGCTGCTGCCCAGCCATCGGCCGAGTGGACATACCCAGGACGCCCTTGCCCGCCTCCCCCACCACGGCCACAGACCTT
TGTCACTCACCAAGGCTGGAATCCCGTGGCTGATCCTGCCTCTGCCCTTTGGCTCCCGGGACTCAGCCCACACCACCTGGGTCACAGAGC
ATCCCATTCCCACACACCGTTGTGGCCACCTCACCAGCAGGGGCAGGCCCATATGCCCAGGTTTGCCTGGTGAGGAGCTGGGGGCGGGGG
TATGCCCCGCCCCGGGAGCTGACGTCATAAAAGGAGCTCTGGAGGGCAGCCCACTCTGGCCTGGCCCCACAGCGGCAGTGTCCCTCCCCT
CCCCCCACTCCTCTCAGTGGGGGCCCCTCCAGTCCCTGAGAATTGGTACTACGAAAAGGTGAACTCCTGGGCAGAATCTTGCCTAGAGCT
TGCGGAGTCCAGCCAGGCCCCTGCTGAAGGGCCCCAGACCACCGGCCACTTCTCCCCCGTCCATCTGACCAGCTGGGCCCCTGCGCCCAC
CTGGCCTCCACGTTCCCTCTCCTCTCACCCACACCCCTGGCCATGGCTAACTACTACGAAGTGCTGGGCGTGCAGGCCAGCGCTTCCCCG
GAGGACATCAAGAAAGCCTACCGCAAGCTGGCCCTTCGTTGGCACCCCGACAAGAACCCTGACAATAAGGAGGAGGCGGAGAAGAAGTTC
AAGCTGGTGTCTGAGGCCTATGAGGTTCTGTCTGACTCCAAGAAACGCTCCCTGTATGACCGTGCTGGCTGTGACAGCTGGCGGGCTGGT
GGCGGGGCCAGCACGCCCTACCACAGCCCCTTCGACACCGGCTACACCTTCCGTAACCCTGAGGACATCTTCCGGGAGTTTTTTGGTGGC
CTGGACCCTTTCTCCTTTGAGTTCTGGGACAGCCCATTCAATAGTGACCGTGGTGGCCGGGGCCATGGCCTGAGGGGGGCCTTCTCGGCA
GGCTTTGGAGAATTTCCGGCCTTCATGGAGGCCTTCTCATCCTTCAACATGCTGGGCTGCAGCGGGGGCAGCCACACCACCTTCTCATCC
ACCTCCTTCGGGGGCTCCAGTTCTGGCAGCTCGGGGTTCAAGTCGGTGATGTCGTCCACCGAGATGATCAATGGCCACAAGGTCACCACC
AAGCGCATCGTGGAGAACGGGCAGGAGCGCGTGGAGGTGGAGGAAGACGGGCAGCTCAAGTCGGTGACTGTGAACGGCAAGGAGCAGCTC
AAATGGATGGACAGCAAGTAGGCGCTGGCCACCCGGCCCTGCCTTCCCACCACCACCACCGTGCATGGGGCAGCAAACACGTGGGGCCGC
AGACATAGCCTGATGGTTAATAAATGTGCCAAGTGAGTTCATGGCA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine51621 %
Guanine63226 %
Thyamine49721 %
Cytosine83034 %
A+T101341 %
G+C146260 %

Total Bases :   2475 bases

Microsatellites
SequencePosition LengthRepeats
ACCACCACC4133
CACCACCAC5233
CCACCACCA12033
TCTCTC16723
ACCACCACC20133
AGGAGGAGG26233
CTCTCT36323
CTCTCT51623
TGTGTG87723
TGTGTG89423
AAAAAA102623
CACACA126923
CCCCCC143923
AGGAGGAGG177633
TTTTTT196723
GGGGGG205223
CCACCACCACCA238534

Microsatellite Map

ACACCGCCTTTGCCATCACCACCGTCATTGCCCCCTCTACTACCACCACCATCACCACCACCGGGTCTGCCTCAGCCAGACCCACCACTG
CCTCTAATTAGACTGCCACCATCATCACTGCCACCACCACTGCCCCTCCAATGCCTTCCTGATGTCACCATCTGCTTTCTCTCTGCTATC
CTCACACCCAACTCCATCAAAACCACCACCTTCATCTGAGCCGCCATCACCCTCACAGTACACAGCCCTCAAATGTGTACCAAGGAGGAG
GACATTTACTACACGCTGCACCCTGAACAGTCTGGGACCAGCGGTCAGGGAACAAGGAATCGAGATGCTCACCTGCAGCTCCCAGGTGAG
CGGCTCTCTAGAGCTTGCCTGGGAGCTGCTGAGGAGCTCACGGTATTCCAGGAAGCTCCCCATCCATGCCTCAGCCTGTGGCTCAGAAGC
AGGGTCTTCGCAGAAGATTGCCCCGAGCTGTTGCAAAGCTCACCATTGTCACCTGCCTGCAACGGCCTCTCTTTTCCACTCTCCAAATCC
CTTGTATTGGCAGGCTCTAGTCTGGAATTATACCGGTGATGGGATTCTGGAAAATCCCTCAGATTTCTCCAGGATGCAAGGAGACCATGG
AAGAGGAACAAGCCTGCAAGGGACAGCAGGTGCTAACTGCTAACCGAGACATAGTGACAAAAATCCAGCCACAGAGATAAAGAATCAGGT
TCATCTGTAGCTACATCCAGTGGAGAAGTTCTGCTCTTCAACTCCTCTGCTAAGCCACATGTGTCAGCAGGTGTAGAATTGAGTGGAACA
CTTCTTTGGATTTGCTGTCCGCTGCAGCCTTGGCCCTGGTTTCACATCCCCTCCCTCACTGACTCGCTGTGTGACCTTGAGCACTGTGTG
TCTCTGAGCCTGGTTCATCCAAGAGTTTACCGACGGCCCTCGTGTGCCAGCCACTGTCCTAGACAGGGACAGACTTTCCCGCCTTTGTGG
AGCTTACCCCGGAAGACCTGGCCAGATAATGGGCACAAAAAAAGCAGGCTCTTGTCCCCACCCCAGCCTGCCTGAACCCCACCTTGGCCT
CCTCTTGCCTCAGCTGCTGCCCAGCCATCGGCCGAGTGGACATACCCAGGACGCCCTTGCCCGCCTCCCCCACCACGGCCACAGACCTTT
GTCACTCACCAAGGCTGGAATCCCGTGGCTGATCCTGCCTCTGCCCTTTGGCTCCCGGGACTCAGCCCACACCACCTGGGTCACAGAGCA
TCCCATTCCCACACACCGTTGTGGCCACCTCACCAGCAGGGGCAGGCCCATATGCCCAGGTTTGCCTGGTGAGGAGCTGGGGGCGGGGGT
ATGCCCCGCCCCGGGAGCTGACGTCATAAAAGGAGCTCTGGAGGGCAGCCCACTCTGGCCTGGCCCCACAGCGGCAGTGTCCCTCCCCTC
CCCCCACTCCTCTCAGTGGGGGCCCCTCCAGTCCCTGAGAATTGGTACTACGAAAAGGTGAACTCCTGGGCAGAATCTTGCCTAGAGCTT
GCGGAGTCCAGCCAGGCCCCTGCTGAAGGGCCCCAGACCACCGGCCACTTCTCCCCCGTCCATCTGACCAGCTGGGCCCCTGCGCCCACC
TGGCCTCCACGTTCCCTCTCCTCTCACCCACACCCCTGGCCATGGCTAACTACTACGAAGTGCTGGGCGTGCAGGCCAGCGCTTCCCCGG
AGGACATCAAGAAAGCCTACCGCAAGCTGGCCCTTCGTTGGCACCCCGACAAGAACCCTGACAATAAGGAGGAGGCGGAGAAGAAGTTCA
AGCTGGTGTCTGAGGCCTATGAGGTTCTGTCTGACTCCAAGAAACGCTCCCTGTATGACCGTGCTGGCTGTGACAGCTGGCGGGCTGGTG
GCGGGGCCAGCACGCCCTACCACAGCCCCTTCGACACCGGCTACACCTTCCGTAACCCTGAGGACATCTTCCGGGAGTTTTTTGGTGGCC
TGGACCCTTTCTCCTTTGAGTTCTGGGACAGCCCATTCAATAGTGACCGTGGTGGCCGGGGCCATGGCCTGAGGGGGGCCTTCTCGGCAG
GCTTTGGAGAATTTCCGGCCTTCATGGAGGCCTTCTCATCCTTCAACATGCTGGGCTGCAGCGGGGGCAGCCACACCACCTTCTCATCCA
CCTCCTTCGGGGGCTCCAGTTCTGGCAGCTCGGGGTTCAAGTCGGTGATGTCGTCCACCGAGATGATCAATGGCCACAAGGTCACCACCA
AGCGCATCGTGGAGAACGGGCAGGAGCGCGTGGAGGTGGAGGAAGACGGGCAGCTCAAGTCGGTGACTGTGAACGGCAAGGAGCAGCTCA
AATGGATGGACAGCAAGTAGGCGCTGGCCACCCGGCCCTGCCTTCCCACCACCACCACCGTGCATGGGGCAGCAAACACGTGGGGCCGCA
GACATAGCCTGATGGTTAATAAATGTGCCAAGTGAGTTCATGGCA

Gene Information
Molecule Type mRNA
Bases 2475 Bases
Molecular Weight760821.92 Da
Coding Sequence 1662..2360
NCBI ReferenceNM_153330
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily B; member 8 (DNAJB8);mRNA. dnaJhomologsubfamilyBmember8

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 3 to 66 64 N-terminal DnaJ domain PF00226

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2DMX Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA47

Accession Number

HSP40_3220

Added on

2012-02-02

Updated On

2014-01-20