Help  Custom Search
 
DnaJ homolog subfamily B member 9 of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily B member 9

Synonymous Names

Q6FIF1_HUMAN, Hsp40/J-protein, DNAJB9 protein, DnaJ (Hsp40) homolog, subfamily B, member 9, DnaJ (Hsp40) homolog, subfamily B, member 9, isoform CRA_b, MSTP049, cDNA FLJ34885 fis, clone NT2NE2016608, highly similar to DnaJ homolog subfamily B member 9, DNAJB9

Gene names

Gene Name

DNAJB9

Gene Locus Tag

UNQ743/PRO1471

Gene Identifier

4189

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREI AEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENH FQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRR GNMVTTYTDCSGQ

FASTA Format Composition Secondary Structure

Nucleotide
 TTTTCGGGGGTTGAAGCCGGAAGTGGCGCACAGCCCTAGCAGCAACAACAGTTTTCCACGTGCGCGTAGGGCGCCGGGATCACGTGGGG
AGGCAGAAGCCAATGGGGAAGCGTTTCGTGTAGGTCTTCTGAGGTGGTGGCGCCAGCGGCTACCTCCTGCCTGTGAGGAGCTGGCTGAGA
GGGGACTGGGCGCCGGCGGGGAAGGAGGAGCGCTAGGTCGGTGTACGACCGAGATTAGGGTGCGTGCCAGCTCCGGGAGGCCGCGGTGAG
GGGCCGGGCCCAAGCTGCCGACCCGAGCCGATCGTCAGGGTCGCCAGCGCCTCAGCTCTGTGGAGGAGCAGCAGTAGTCGGAGGGTGCAG
GATATTAGAAATGGCTACTCCCCAGTCAATTTTCATCTTTGCAATCTGCATTTTAATGATAACAGAATTAATTCTGGCCTCAAAAAGCTA
CTATGATATCTTAGGTGTGCCAAAATCGGCATCAGAGCGCCAAATCAAGAAGGCCTTTCACAAGTTGGCCATGAAGTACCACCCTGACAA
AAATAAGAGCCCGGATGCTGAAGCAAAATTCAGAGAGATTGCAGAAGCATATGAAACACTCTCAGATGCTAATAGACGAAAAGAGTATGA
TACACTTGGACACAGTGCTTTTACTAGTGGTAAAGGACAAAGAGGTAGTGGAAGTTCTTTTGAGCAGTCATTTAACTTCAATTTTGATGA
CTTATTTAAAGACTTTGGCTTTTTTGGTCAAAACCAAAACACTGGATCCAAGAAGCGTTTTGAAAATCATTTCCAGACACGCCAGGATGG
TGGTTCCAGTAGACAAAGGCATCATTTCCAAGAATTTTCTTTTGGAGGTGGATTATTTGATGACATGTTTGAAGATATGGAGAAAATGTT
TTCTTTTAGTGGTTTTGACTCTACCAATCAGCATACAGTACAGACTGAAAATAGATTTCATGGATCTAGCAAGCACTGCAGGACTGTCAC
TCAACGAAGAGGAAATATGGTTACTACATACACTGACTGTTCAGGACAGTAGTTCTTATTCTATTCTCACTAAATCCAACTGGTTGACTC
TTCCTCATTATCTTTGATGCTAAACAATTTTCTGTGAACTATTTTGACAAGTGCATGATTTCACTTTAAACAATTTGATATAGCTATTAA
ATATATTTAAGGGTTTTTTTTTTTTGACAAATTCAACATTCAACGAGTAGACAAAATGCTAATTATTTCCCTGATTAGGAAAGTTTCTTT
AAAAAACACGTAATTTTGCCTAGTGCTTTTTCTCTACCTGCCCTTGGGCTCACTAATATCACCAGTATTATTACCAAGAAAATATTGAGT
TTACCTGATTAAACTTTAAAAGTTAATTGTAGATTTAAATTGTGTGAACCTAATGATTTTTGCAGTGAAACCTTTACTAATTCAAAGTTG
CATGTTCTATGACATCTGTGACTTGCGTTGCAGAGTGTACATGAAACTGTATAATTGAGTCATTCAGTAAAGGAGAACAGTATCTTGGTT
AATTGCTACTGAAAGGTTGAGAAAGGAATGGTTTGATATTTACCACAGCGCTGTGCCTTTCTACAGTAGAACTGGGGTAAAGGAAATGGT
TTTATTGCCCATAGTCATTTAGGCTGGAAAAAAGTTGAAAACTTAACGAAATATTGCCAAGAGATTGTTATGTGTTTGGTTCCAGCCTAA
AAATGATTTTGTAGTGTTGAAATCATAGCTACTTACATAGCTTTTTCATATTTCTTTCTTAGTTGTTGGCACTCTTAGGTCTTAGTATGG
ATTTATGTGTTTGTGTGTGTGTAGTTTATCCTCTCTCTCATCTTTATCTAGAGATTGACTGATACCTCATTCTGTTTGTAAAACCAGCCA
GTAATTTCTGTGCAACCTTACTATGTGCAATATTTTTAAATCCTGAGAAATGTGTGCTTTTGTTTTCGGATAGACTTATTTCTTTAGTTC
TGCACTTTTCCACATTATACTCCATATGAGTATTAATCCTATGGATACATATTAAAACAAGTGTCTCATACAACATTGTATGTGAGAGAA
ATATAAATATTTACAACCTGATATTCGTTGTTGTTTTATTGTTAAAAGTTTATTATGCAACTCTGGAGGTATAGAGGGCATATAAGCTAT
GGGACATATGCTGATCACAGGCTATATTCATGAAGTTACTTTTGACCAACCTGAAAACTGATAGGATTTTGTTTGTCATTTGGTAATTTC
TACTGCATTCTTACCATCCTTCTCTCACAAATTTTGATAGCTTGAAGATCTTTTTAATTATAATTTTGTTGTATTTGTTTCCTAGGAGCA
AGTGTTCCTGCTGCCAGTTCTTTCCTCTTTAGGCGTGGTTGAGAAAAAGCAGAAACTTTACATAAAGCTGTATTTCTTAATCATCTTTAA
TTTGAAACTTAAGAAAATGAATTTATTCTGTTATATTTATGTAACTTATTTCCTGGAAGTTATATCTACTAGTTTTGTTTGATAATAATA
AAATTAGCTATACCTTGAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine72829 %
Guanine53622 %
Thyamine83433 %
Cytosine44018 %
A+T156262 %
G+C97639 %

Total Bases :   2538 bases

Microsatellites
SequencePosition LengthRepeats
AGAGAG57023
TTTTTT73823
ATATAT116923
TTTTTTTTTTTT118226
AAAAAA125923
TGTGTG138923
AAAAAA164623
TGTGTGTGTG181025
CTCTCTCT182924
TGTGTG193923
GAGAGA206223
GTTGTTGTT209533
TCTCTC226923
ATAATAATA251033

Microsatellite Map

TTTTCGGGGGTTGAAGCCGGAAGTGGCGCACAGCCCTAGCAGCAACAACAGTTTTCCACGTGCGCGTAGGGCGCCGGGATCACGTGGGGA
GGCAGAAGCCAATGGGGAAGCGTTTCGTGTAGGTCTTCTGAGGTGGTGGCGCCAGCGGCTACCTCCTGCCTGTGAGGAGCTGGCTGAGAG
GGGACTGGGCGCCGGCGGGGAAGGAGGAGCGCTAGGTCGGTGTACGACCGAGATTAGGGTGCGTGCCAGCTCCGGGAGGCCGCGGTGAGG
GGCCGGGCCCAAGCTGCCGACCCGAGCCGATCGTCAGGGTCGCCAGCGCCTCAGCTCTGTGGAGGAGCAGCAGTAGTCGGAGGGTGCAGG
ATATTAGAAATGGCTACTCCCCAGTCAATTTTCATCTTTGCAATCTGCATTTTAATGATAACAGAATTAATTCTGGCCTCAAAAAGCTAC
TATGATATCTTAGGTGTGCCAAAATCGGCATCAGAGCGCCAAATCAAGAAGGCCTTTCACAAGTTGGCCATGAAGTACCACCCTGACAAA
AATAAGAGCCCGGATGCTGAAGCAAAATTCAGAGAGATTGCAGAAGCATATGAAACACTCTCAGATGCTAATAGACGAAAAGAGTATGAT
ACACTTGGACACAGTGCTTTTACTAGTGGTAAAGGACAAAGAGGTAGTGGAAGTTCTTTTGAGCAGTCATTTAACTTCAATTTTGATGAC
TTATTTAAAGACTTTGGCTTTTTTGGTCAAAACCAAAACACTGGATCCAAGAAGCGTTTTGAAAATCATTTCCAGACACGCCAGGATGGT
GGTTCCAGTAGACAAAGGCATCATTTCCAAGAATTTTCTTTTGGAGGTGGATTATTTGATGACATGTTTGAAGATATGGAGAAAATGTTT
TCTTTTAGTGGTTTTGACTCTACCAATCAGCATACAGTACAGACTGAAAATAGATTTCATGGATCTAGCAAGCACTGCAGGACTGTCACT
CAACGAAGAGGAAATATGGTTACTACATACACTGACTGTTCAGGACAGTAGTTCTTATTCTATTCTCACTAAATCCAACTGGTTGACTCT
TCCTCATTATCTTTGATGCTAAACAATTTTCTGTGAACTATTTTGACAAGTGCATGATTTCACTTTAAACAATTTGATATAGCTATTAAA
TATATTTAAGGGTTTTTTTTTTTTGACAAATTCAACATTCAACGAGTAGACAAAATGCTAATTATTTCCCTGATTAGGAAAGTTTCTTTA
AAAAACACGTAATTTTGCCTAGTGCTTTTTCTCTACCTGCCCTTGGGCTCACTAATATCACCAGTATTATTACCAAGAAAATATTGAGTT
TACCTGATTAAACTTTAAAAGTTAATTGTAGATTTAAATTGTGTGAACCTAATGATTTTTGCAGTGAAACCTTTACTAATTCAAAGTTGC
ATGTTCTATGACATCTGTGACTTGCGTTGCAGAGTGTACATGAAACTGTATAATTGAGTCATTCAGTAAAGGAGAACAGTATCTTGGTTA
ATTGCTACTGAAAGGTTGAGAAAGGAATGGTTTGATATTTACCACAGCGCTGTGCCTTTCTACAGTAGAACTGGGGTAAAGGAAATGGTT
TTATTGCCCATAGTCATTTAGGCTGGAAAAAAGTTGAAAACTTAACGAAATATTGCCAAGAGATTGTTATGTGTTTGGTTCCAGCCTAAA
AATGATTTTGTAGTGTTGAAATCATAGCTACTTACATAGCTTTTTCATATTTCTTTCTTAGTTGTTGGCACTCTTAGGTCTTAGTATGGA
TTTATGTGTTTGTGTGTGTGTAGTTTATCCTCTCTCTCATCTTTATCTAGAGATTGACTGATACCTCATTCTGTTTGTAAAACCAGCCAG
TAATTTCTGTGCAACCTTACTATGTGCAATATTTTTAAATCCTGAGAAATGTGTGCTTTTGTTTTCGGATAGACTTATTTCTTTAGTTCT
GCACTTTTCCACATTATACTCCATATGAGTATTAATCCTATGGATACATATTAAAACAAGTGTCTCATACAACATTGTATGTGAGAGAAA
TATAAATATTTACAACCTGATATTCGTTGTTGTTTTATTGTTAAAAGTTTATTATGCAACTCTGGAGGTATAGAGGGCATATAAGCTATG
GGACATATGCTGATCACAGGCTATATTCATGAAGTTACTTTTGACCAACCTGAAAACTGATAGGATTTTGTTTGTCATTTGGTAATTTCT
ACTGCATTCTTACCATCCTTCTCTCACAAATTTTGATAGCTTGAAGATCTTTTTAATTATAATTTTGTTGTATTTGTTTCCTAGGAGCAA
GTGTTCCTGCTGCCAGTTCTTTCCTCTTTAGGCGTGGTTGAGAAAAAGCAGAAACTTTACATAAAGCTGTATTTCTTAATCATCTTTAAT
TTGAAACTTAAGAAAATGAATTTATTCTGTTATATTTATGTAACTTATTTCCTGGAAGTTATATCTACTAGTTTTGTTTGATAATAATAA
AATTAGCTATACCTTGAA

Gene Information
Molecule Type mRNA
Bases 2538 Bases
Molecular Weight785353.48 Da
Coding Sequence 370..1041
NCBI ReferenceNM_012328
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily B; member 9 (DNAJB9);mRNA. dnaJhomologsubfamilyBmember9precursor

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
SignalP 1 to 23 23 Signal peptide region Manually identified
J-domain 26 to 87 62 N-terminal DnaJ domain PF00226
G/F-rich region 90 to 182 93 Glycine-phenylalanine rich region Manually identified
TMhelix 7 to 24 18 Transmembrane helix region Manually identified

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2CTR Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA30

Accession Number

HSP40_3203

Added on

2012-02-02

Updated On

2014-01-20