Help  Custom Search
 
DnaJ homolog subfamily B member 1 of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily B member 1

Synonymous Names

DNJB1_HUMAN, Hsp40/J-protein, DnaJ protein homolog 1, Heat shock 40 kDa protein 1, HSP40, Heat shock protein 40, Human DnaJ protein 1, hDj-1, DNAJB1

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type II J-Protein

SEQUENCE INFORMATION

Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGG FTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT IPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

FASTA Format Composition Secondary Structure

Nucleotide
 GGGACGGCGACAGCGGGTCGGCGGGCCGCAGGAGGGGGTCATGGGTAAAGACTACTACCAGACGTTGGGCCTGGCCCGCGGCGCGTCGG
ACGAGGAGATCAAGCGGGCCTACCGCCGCCAGGCGCTGCGCTACCACCCGGACAAGAACAAGGAGCCCGGCGCCGAGGAGAAGTTCAAGG
AGATCGCTGAGGCCTACGACGTGCTCAGCGACCCGCGCAAGCGCGAGATCTTCGACCGCTACGGGGAGGAAGGCCTAAAGGGGAGTGGCC
CCAGTGGCGGTAGCGGCGGTGGTGCCAATGGTACCTCTTTCAGCTACACATTCCATGGAGACCCTCATGCCATGTTTGCTGAGTTCTTCG
GTGGCAGAAATCCCTTTGACACCTTTTTTGGGCAGCGGAACGGGGAGGAAGGCATGGACATTGATGACCCATTCTCTGGCTTCCCTATGG
GCATGGGTGGCTTCACCAACGTGAACTTTGGCCGCTCCCGCTCTGCCCAAGAGCCCGCCCGAAAGAAGCAAGATCCCCCAGTCACCCACG
ACCTTCGAGTCTCCCTTGAAGAGATCTACAGCGGCTGTACCAAGAAGATGAAAATCTCCCACAAGCGGCTAAACCCCGACGGAAAGAGCA
TTCGAAACGAAGACAAAATATTGACCATCGAAGTGAAGAAGGGGTGGAAAGAAGGAACCAAAATCACTTTCCCCAAGGAAGGAGACCAGA
CCTCCAACAACATTCCAGCTGATATCGTCTTTGTTTTAAAGGACAAGCCCCACAATATCTTTAAGAGAGATGGCTCTGATGTCATTTATC
CTGCCAGGATCAGCCTCCGGGAGGCTCTGTGTGGCTGCACAGTGAACGTCCCCACTCTGGACGGCAGGACGATACCCGTCGTATTCAAAG
ATGTTATCAGGCCTGGCATGCGGCGAAAAGTTCCTGGAGAAGGCCTCCCCCTCCCCAAAACACCCGAGAAACGTGGGGACCTCATTATTG
AGTTTGAAGTGATCTTCCCCGAAAGGATTCCCCAGACATCAAGAACCGTACTTGAGCAGGTTCTTCCAATATAGCTATCTGAGCTCCCCA
AGGACTGACCAGGGACCTTTCCAGAGCTCAAGGATTTCTGGACCTTTCTACCAGTTGTGGACCATGAGAGGGTGGGAGGGCCCAGGGAGG
GCTTTCGTACTGCTGAATGTTTTCCAGAGCATATATTACAATCTTTCAAAGTCGCACACTAGACTTCAGTGGTTTTTCGAGCTATAGGGC
ATCAGGTGGTGGGAACAGCAGGAAAAGGCATTCCAGTCTGCCCCACTGGGTCTGGCAGCCCTCCCGGGATGGGCCCACATCCACCTCCAG
TCCCTGGCCAGGGGTGAGAGGCAGACCAGCAGATGGACTTGATCCCTCTGTGTCTTTGGGCTTCTGGCTGGTAGATAATGTCAACCTGCA
GTCTTGATTCCCAGACCCTGTACACTCCTCCTTTTCTGTTGTGTGATCAGTTTGTGCTTTATTCTGTATTTGTCTCCCATGTCTTGCTCT
TCTCCTGGAGAATTCTGTCTTCTCTTTGGCCATCTCAAATTGAGAACCTAAACTATTCCTGCAGAACTGCCTGGTTGGCGTCCACAAGCA
ATACCTCTCGTTCCAGCAGGACCAAGGGAGCCAGCCTCCAGTGAGTGACTCCAGCAAGTGCAGCCACCTCTCCCTTGATGGTCTGGGAGC
CTGGCCTCAGCAAGGGGCCTTCCTGACCTCTGGCTCCAGTGAAGCTGAATGTCCTCACTTTGTGGGTCACACTCTTTACATTTCTGTAAG
GCAATCTTGGCACACGTGGGGCTTACCAGTGGCCCAGGTAATTTTTTGTTTCATGGACTATGGACTCTTTCAAAGGGATCTGATCCTTTT
GAATTTTGCACAGCCCTAGATACAATCCCTTTTGATAAAAGGGTCTTTGCTTCTGATTACAGGAGCACTGTGGAACGTCTGTAAATATGT
TTTTATAATTCCATGTATAGTTGGTGTACACTCAAAACCTGTCCCCGGCAGCCAGTGCTCTCTGTATAGGGCCATAATGGAATTCTGAAG
AAATCTTGGGGAGGGAAGGGGAGTTGGAACAAATGTCTGTTCCCTGGAGGCCAGTCCAGTGCTCAGACCTTTAGACTCATTGTAAGTTGC
CACTGCCAACATGAGACCAAAGTGTGTGACTAGTCAATGAAGTGCGACAGCATTAAAGACTGATGCTAAACCTC 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine53124 %
Guanine58927 %
Thyamine52324 %
Cytosine59027 %
A+T105448 %
G+C117953 %

Total Bases :   2233 bases

Microsatellites
SequencePosition LengthRepeats
TTTTTT38223
AGAGAG78223
TGTGTG83623
ATATAT119923
TGTGTG147823
TTTTTT184023
CTCTCT203623
GTGTGT218023

Microsatellite Map

GGGACGGCGACAGCGGGTCGGCGGGCCGCAGGAGGGGGTCATGGGTAAAGACTACTACCAGACGTTGGGCCTGGCCCGCGGCGCGTCGGA
CGAGGAGATCAAGCGGGCCTACCGCCGCCAGGCGCTGCGCTACCACCCGGACAAGAACAAGGAGCCCGGCGCCGAGGAGAAGTTCAAGGA
GATCGCTGAGGCCTACGACGTGCTCAGCGACCCGCGCAAGCGCGAGATCTTCGACCGCTACGGGGAGGAAGGCCTAAAGGGGAGTGGCCC
CAGTGGCGGTAGCGGCGGTGGTGCCAATGGTACCTCTTTCAGCTACACATTCCATGGAGACCCTCATGCCATGTTTGCTGAGTTCTTCGG
TGGCAGAAATCCCTTTGACACCTTTTTTGGGCAGCGGAACGGGGAGGAAGGCATGGACATTGATGACCCATTCTCTGGCTTCCCTATGGG
CATGGGTGGCTTCACCAACGTGAACTTTGGCCGCTCCCGCTCTGCCCAAGAGCCCGCCCGAAAGAAGCAAGATCCCCCAGTCACCCACGA
CCTTCGAGTCTCCCTTGAAGAGATCTACAGCGGCTGTACCAAGAAGATGAAAATCTCCCACAAGCGGCTAAACCCCGACGGAAAGAGCAT
TCGAAACGAAGACAAAATATTGACCATCGAAGTGAAGAAGGGGTGGAAAGAAGGAACCAAAATCACTTTCCCCAAGGAAGGAGACCAGAC
CTCCAACAACATTCCAGCTGATATCGTCTTTGTTTTAAAGGACAAGCCCCACAATATCTTTAAGAGAGATGGCTCTGATGTCATTTATCC
TGCCAGGATCAGCCTCCGGGAGGCTCTGTGTGGCTGCACAGTGAACGTCCCCACTCTGGACGGCAGGACGATACCCGTCGTATTCAAAGA
TGTTATCAGGCCTGGCATGCGGCGAAAAGTTCCTGGAGAAGGCCTCCCCCTCCCCAAAACACCCGAGAAACGTGGGGACCTCATTATTGA
GTTTGAAGTGATCTTCCCCGAAAGGATTCCCCAGACATCAAGAACCGTACTTGAGCAGGTTCTTCCAATATAGCTATCTGAGCTCCCCAA
GGACTGACCAGGGACCTTTCCAGAGCTCAAGGATTTCTGGACCTTTCTACCAGTTGTGGACCATGAGAGGGTGGGAGGGCCCAGGGAGGG
CTTTCGTACTGCTGAATGTTTTCCAGAGCATATATTACAATCTTTCAAAGTCGCACACTAGACTTCAGTGGTTTTTCGAGCTATAGGGCA
TCAGGTGGTGGGAACAGCAGGAAAAGGCATTCCAGTCTGCCCCACTGGGTCTGGCAGCCCTCCCGGGATGGGCCCACATCCACCTCCAGT
CCCTGGCCAGGGGTGAGAGGCAGACCAGCAGATGGACTTGATCCCTCTGTGTCTTTGGGCTTCTGGCTGGTAGATAATGTCAACCTGCAG
TCTTGATTCCCAGACCCTGTACACTCCTCCTTTTCTGTTGTGTGATCAGTTTGTGCTTTATTCTGTATTTGTCTCCCATGTCTTGCTCTT
CTCCTGGAGAATTCTGTCTTCTCTTTGGCCATCTCAAATTGAGAACCTAAACTATTCCTGCAGAACTGCCTGGTTGGCGTCCACAAGCAA
TACCTCTCGTTCCAGCAGGACCAAGGGAGCCAGCCTCCAGTGAGTGACTCCAGCAAGTGCAGCCACCTCTCCCTTGATGGTCTGGGAGCC
TGGCCTCAGCAAGGGGCCTTCCTGACCTCTGGCTCCAGTGAAGCTGAATGTCCTCACTTTGTGGGTCACACTCTTTACATTTCTGTAAGG
CAATCTTGGCACACGTGGGGCTTACCAGTGGCCCAGGTAATTTTTTGTTTCATGGACTATGGACTCTTTCAAAGGGATCTGATCCTTTTG
AATTTTGCACAGCCCTAGATACAATCCCTTTTGATAAAAGGGTCTTTGCTTCTGATTACAGGAGCACTGTGGAACGTCTGTAAATATGTT
TTTATAATTCCATGTATAGTTGGTGTACACTCAAAACCTGTCCCCGGCAGCCAGTGCTCTCTGTATAGGGCCATAATGGAATTCTGAAGA
AATCTTGGGGAGGGAAGGGGAGTTGGAACAAATGTCTGTTCCCTGGAGGCCAGTCCAGTGCTCAGACCTTTAGACTCATTGTAAGTTGCC
ACTGCCAACATGAGACCAAAGTGTGTGACTAGTCAATGAAGTGCGACAGCATTAAAGACTGATGCTAAACCTC

Gene Information
Molecule Type mRNA
Bases 2233 Bases
Molecular Weight689870.04 Da
Coding Sequence 41..1063
NCBI ReferenceNM_006145
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily B; member 1 (DNAJB1);mRNA. dnaJhomologsubfamilyBmember1

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 4 to 65 62 N-terminal DnaJ domain PF00226
G/F-rich region 68 to 147 80 Glycine-phenylalanine rich region Manually identified
C-terminal domain 253 to 333 81 DnaJ C terminal region PF01556

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

1HDJ Jmol
2QLD Jmol
3AGX Jmol
3AGY Jmol
3AGZ Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA17

Accession Number

HSP40_3190

Added on

2012-02-02

Updated On

2014-01-20