Help  Custom Search
 
DnaJ homolog subfamily A member 3, mitochondrial isoform 1 of Homo sapiens

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ homolog subfamily A member 3, mitochondrial isoform 1

Synonymous Names

Q53G26_HUMAN, Hsp40/J-protein, DnaJ (Hsp40) homolog, subfamily A, member 3 variant, DnaJ (Hsp40) homolog, subfamily A, member 3, isoform CRA_b, DNAJA3, HCA57, TID1

Gene names

Gene Name

DNAJA3

Gene Locus Tag

hCG_15165

Gene Identifier

9093

Taxon Information

Organism

Homo sapiens

Organism ID

9606 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo sapiens

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLT GTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAE AYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQE YFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGG RGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDL FISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS

FASTA Format Composition Secondary Structure

Nucleotide
 CGCCTCTACGCGCGCCCGCCGTTCCCGCGAGGCCCACCTAGAGCCGGGCGGCGCAGGCGCAGAGTCCCCGGGCCAAGATGGCTGCGCGG
TGCTCCACACGCTGGTTGCTGGTGGTTGTGGGGACCCCGCGGCTGCCGGCTATATCGGGTAGAGGGGCCCGGCCGCCCAGGGAGGGCGTG
GTGGGGGCATGGCTGAGCCGCAAGCTGAGCGTCCCCGCCTTTGCGTCTTCCCTGACCTCTTGCGGCCCCCGAGCGCTGCTGACATTGAGA
CCTGGTGTCAGCCTTACAGGAACAAAACATAACCCTTTCATTTGTACTGCCTCCTTCCACACGAGTGCCCCTTTGGCCAAAGAAGATTAT
TATCAGATATTAGGAGTGCCTCGAAATGCCAGCCAGAAAGAGATCAAGAAAGCCTATTATCAGCTTGCCAAGAAGTATCACCCTGACACA
AATAAGGATGATCCCAAAGCCAAGGAGAAGTTCTCCCAGCTGGCAGAAGCCTATGAGGTTTTGAGTGATGAGGTGAAGAGGAAGCAGTAC
GATGCCTACGGCTCTGCAGGCTTCGATCCTGGGGCCAGCGGCTCCCAGCATAGCTACTGGAAGGGAGGCCCCACTGTGGACCCCGAGGAG
CTGTTCAGGAAGATCTTTGGCGAGTTCTCATCCTCTTCATTTGGAGATTTCCAGACCGTGTTTGATCAGCCTCAGGAATACTTCATGGAG
TTGACATTCAATCAAGCTGCAAAGGGGGTCAACAAGGAGTTCACCGTGAACATCATGGACACGTGTGAGCGCTGCAACGGCAAGGGGAAC
GAGCCCGGCACCAAGGTGCAGCATTGCCACTACTGTGGCGGCTCCGGCATGGAAACCATCAACACAGGCCCTTTTGTGATGCGTTCCACG
TGTAGGAGATGTGGTGGCCGCGGCTCCATCATCATATCGCCCTGTGTGGTCTGCAGGGGAGCAGGACAAGCCAAGCAGAAAAAGCGAGTG
ATGATCCCTGTGCCTGCAGGAGTCGAGGATGGCCAGACCGTGAGGATGCCTGTGGGAAAAAGGGAAATTTTCATTACGTTCAGGGTGCAG
AAAAGCCCTGTGTTCCGGAGGGACGGCGCAGACATCCACTCCGACCTCTTTATTTCTATAGCTCAGGCTCTTCTTGGGGGTACAGCCAGA
GCCCAGGGCCTGTACGAGACGATCAACGTGACGATCCCCCCTGGGACTCAGACAGACCAGAAGATTCGGATGGGTGGGAAAGGCATCCCC
CGGATTAACAGCTACGGCTACGGAGACCACTACATCCACATCAAGATACGAGTTCCAAAGAGGCTAACGAGCCGGCAGCAGAGCCTGATC
CTGAGCTACGCCGAGGACGAGACAGATGTGGAGGGGACGGTGAACGGCGTCACCCTCACCAGCTCTGGTGGCAGCACCATGGATAGCTCC
GCAGGAAGCAAGGCTAGGCGTGAGGCTGGGGAGGACGAGGAGGGATTCCTTTCCAAACTTAAGAAAATGTTTACCTCATGATATCCCAGC
CGAGGAAAAAGATCCACTGGAAACTAGGCCGGGAAGCAGCAGCCCCTCCAAGGGCCAGGGCACCTGGGAGACGGGAGGATTCCAGAACAG
CAGCACTGAGCTCCCACCCGCAGAGCCTCTGGACGGCCTTGGCAACAGCAAAATCATGGGACAACACCTCTCTCCACGGAAAGGTCACAG
TGGACAGCCCGGGCAGTAGGATGCAGCCCCAGAGGCTGGTGGCAGTTTCCTGTCCATTGGTAGGTGACGGCCCCTGGCTCAGGCAGAGGG
AGATGGTTAGACTCTTGCAGGGCTAAAACTCTAATTTGGAATTGAATATTGTGGATATCTTAGTTAAAGGCCATGCTTACAGCTTAGAAA
TGAAGCCTTAAGCTGCATCAAGTTACGAAGTGATTAATTTCCTTCTCAGCAAACCTCCGGGAGGTTCCAGAATGAGTTCTTCCTGACAGG
TTGTCTTCACTGGGAGCGTGGGGCCCCCAGGCCCCACCAGCACCGTCCTCCCCTAATGAGGGGCCCTGCCGAGGCATCAGCTGCTCTGCT
CAGTTAGTTTTTATTCCCGGGGTACCAAGCAGCTGCACAGTCGGTGCCTGGGAGGCACGTAGAGGCCCAGAGAGTCCCTGGGGGTTCTGC
TCTGACCGTGTGGGTGGTGATCCTTGTCAGGATGTACAGTCCTTGCTCCCACCCCATCCGGGATGGCCGCCTGTCCCTGACTATTGAGTC
CTGTTGTTGTAAGCCAGGCATGGAGGGCTCCTGCCCTTCTGCTGAGCCACAGCCCATTGCAGCACTGTGCTGGCCAGACTTCAGCTGCCT
TGGGAACTGAAGCCCTGCCACTGTTGCTAGTCAGGGGCTTGGTTCTCCCACTTACACTGTTGACATCTATTTTCTGAAGTGTGTTTAAAT
TATTCAGTGCTAATCATTGTTTTTTCCTTTGTAAATGTTGATTCAGAAAAGGAAAGCACAGGCTAAGCAGTTGAAGGTTCCCCACCATTC
AGTGAGAGCAGAACCCCCATTCCCCAGCCTCTGCTGGTAGCATGTCGCAGTTTCCATGTGTTTCAGGATCTTCGGGCTGTCGTTAGACAG
GTTAATGAAGAACACTTCTCAACAGTTTCCTTTTTGTTTTCCTTTATAATTCACTAAAATAAAGCATCTATTAGTGTCTGATTTAGGAAT
GTAAAATGATTCTGTATTAATGTAAATAAGATTATCTATTGCAAAAAGATATTTCAAACCTAAAAAAAAAAAAAAAAAAAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine67125 %
Guanine77528 %
Thyamine60922 %
Cytosine72527 %
A+T128047 %
G+C150054 %

Total Bases :   2780 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG823
CATCATCAT92533
TGTGTG94123
CCCCCC120423
AGCAGCAGC156333
CTCTCT168623
AGAGAG213723
TGTTGTTGT225033
GTGTGT241723
TTTTTT244823
AAAAAAAAAAAAAAAAAAAA2760210

Microsatellite Map

CGCCTCTACGCGCGCCCGCCGTTCCCGCGAGGCCCACCTAGAGCCGGGCGGCGCAGGCGCAGAGTCCCCGGGCCAAGATGGCTGCGCGGT
GCTCCACACGCTGGTTGCTGGTGGTTGTGGGGACCCCGCGGCTGCCGGCTATATCGGGTAGAGGGGCCCGGCCGCCCAGGGAGGGCGTGG
TGGGGGCATGGCTGAGCCGCAAGCTGAGCGTCCCCGCCTTTGCGTCTTCCCTGACCTCTTGCGGCCCCCGAGCGCTGCTGACATTGAGAC
CTGGTGTCAGCCTTACAGGAACAAAACATAACCCTTTCATTTGTACTGCCTCCTTCCACACGAGTGCCCCTTTGGCCAAAGAAGATTATT
ATCAGATATTAGGAGTGCCTCGAAATGCCAGCCAGAAAGAGATCAAGAAAGCCTATTATCAGCTTGCCAAGAAGTATCACCCTGACACAA
ATAAGGATGATCCCAAAGCCAAGGAGAAGTTCTCCCAGCTGGCAGAAGCCTATGAGGTTTTGAGTGATGAGGTGAAGAGGAAGCAGTACG
ATGCCTACGGCTCTGCAGGCTTCGATCCTGGGGCCAGCGGCTCCCAGCATAGCTACTGGAAGGGAGGCCCCACTGTGGACCCCGAGGAGC
TGTTCAGGAAGATCTTTGGCGAGTTCTCATCCTCTTCATTTGGAGATTTCCAGACCGTGTTTGATCAGCCTCAGGAATACTTCATGGAGT
TGACATTCAATCAAGCTGCAAAGGGGGTCAACAAGGAGTTCACCGTGAACATCATGGACACGTGTGAGCGCTGCAACGGCAAGGGGAACG
AGCCCGGCACCAAGGTGCAGCATTGCCACTACTGTGGCGGCTCCGGCATGGAAACCATCAACACAGGCCCTTTTGTGATGCGTTCCACGT
GTAGGAGATGTGGTGGCCGCGGCTCCATCATCATATCGCCCTGTGTGGTCTGCAGGGGAGCAGGACAAGCCAAGCAGAAAAAGCGAGTGA
TGATCCCTGTGCCTGCAGGAGTCGAGGATGGCCAGACCGTGAGGATGCCTGTGGGAAAAAGGGAAATTTTCATTACGTTCAGGGTGCAGA
AAAGCCCTGTGTTCCGGAGGGACGGCGCAGACATCCACTCCGACCTCTTTATTTCTATAGCTCAGGCTCTTCTTGGGGGTACAGCCAGAG
CCCAGGGCCTGTACGAGACGATCAACGTGACGATCCCCCCTGGGACTCAGACAGACCAGAAGATTCGGATGGGTGGGAAAGGCATCCCCC
GGATTAACAGCTACGGCTACGGAGACCACTACATCCACATCAAGATACGAGTTCCAAAGAGGCTAACGAGCCGGCAGCAGAGCCTGATCC
TGAGCTACGCCGAGGACGAGACAGATGTGGAGGGGACGGTGAACGGCGTCACCCTCACCAGCTCTGGTGGCAGCACCATGGATAGCTCCG
CAGGAAGCAAGGCTAGGCGTGAGGCTGGGGAGGACGAGGAGGGATTCCTTTCCAAACTTAAGAAAATGTTTACCTCATGATATCCCAGCC
GAGGAAAAAGATCCACTGGAAACTAGGCCGGGAAGCAGCAGCCCCTCCAAGGGCCAGGGCACCTGGGAGACGGGAGGATTCCAGAACAGC
AGCACTGAGCTCCCACCCGCAGAGCCTCTGGACGGCCTTGGCAACAGCAAAATCATGGGACAACACCTCTCTCCACGGAAAGGTCACAGT
GGACAGCCCGGGCAGTAGGATGCAGCCCCAGAGGCTGGTGGCAGTTTCCTGTCCATTGGTAGGTGACGGCCCCTGGCTCAGGCAGAGGGA
GATGGTTAGACTCTTGCAGGGCTAAAACTCTAATTTGGAATTGAATATTGTGGATATCTTAGTTAAAGGCCATGCTTACAGCTTAGAAAT
GAAGCCTTAAGCTGCATCAAGTTACGAAGTGATTAATTTCCTTCTCAGCAAACCTCCGGGAGGTTCCAGAATGAGTTCTTCCTGACAGGT
TGTCTTCACTGGGAGCGTGGGGCCCCCAGGCCCCACCAGCACCGTCCTCCCCTAATGAGGGGCCCTGCCGAGGCATCAGCTGCTCTGCTC
AGTTAGTTTTTATTCCCGGGGTACCAAGCAGCTGCACAGTCGGTGCCTGGGAGGCACGTAGAGGCCCAGAGAGTCCCTGGGGGTTCTGCT
CTGACCGTGTGGGTGGTGATCCTTGTCAGGATGTACAGTCCTTGCTCCCACCCCATCCGGGATGGCCGCCTGTCCCTGACTATTGAGTCC
TGTTGTTGTAAGCCAGGCATGGAGGGCTCCTGCCCTTCTGCTGAGCCACAGCCCATTGCAGCACTGTGCTGGCCAGACTTCAGCTGCCTT
GGGAACTGAAGCCCTGCCACTGTTGCTAGTCAGGGGCTTGGTTCTCCCACTTACACTGTTGACATCTATTTTCTGAAGTGTGTTTAAATT
ATTCAGTGCTAATCATTGTTTTTTCCTTTGTAAATGTTGATTCAGAAAAGGAAAGCACAGGCTAAGCAGTTGAAGGTTCCCCACCATTCA
GTGAGAGCAGAACCCCCATTCCCCAGCCTCTGCTGGTAGCATGTCGCAGTTTCCATGTGTTTCAGGATCTTCGGGCTGTCGTTAGACAGG
TTAATGAAGAACACTTCTCAACAGTTTCCTTTTTGTTTTCCTTTATAATTCACTAAAATAAAGCATCTATTAGTGTCTGATTTAGGAATG
TAAAATGATTCTGTATTAATGTAAATAAGATTATCTATTGCAAAAAGATATTTCAAACCTAAAAAAAAAAAAAAAAAAAA

Gene Information
Molecule Type mRNA
Bases 2780 Bases
Molecular Weight860153 Da
Coding Sequence 78..1520
NCBI ReferenceNM_005147
Notes Homo sapiens DnaJ (Hsp40) homolog; subfamily A; member 3 (DNAJA3);nuclear gene encoding mitochondrial protein; transcript variant 1;mRNA. dnaJhomologsubfamilyAmember3;mitochondrial

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
SignalP 1 to 90 90 Signal peptide region Manually identified
J-domain 93 to 155 63 N-terminal DnaJ domain PF00226
G/F-rich region 161 to 201 41 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 236 to 296 61 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 345 to 423 79 DnaJ C terminal region PF01556

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2CTT Jmol
2DN9 Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_HOSA1

Accession Number

HSP40_3174

Added on

2012-02-02

Updated On

2014-01-20