Help  Custom Search
 
DNaJ domain (prokaryotic heat shock protein) family member (dnj-12) of Caenorhabditis elegans

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DNaJ domain (prokaryotic heat shock protein) family member (dnj-12)

Synonymous Names

O45502_CAEEL, HSP40 / J-protein, DnaJ

Gene names

Gene Name

Dnj-12

Gene Locus Tag

F39B2.10

Gene Identifier

173341

Taxon Information

Organism

Caenorhabditis elegans

Organism ID

6239 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Nematoda; Chromadorea; Rhabditida; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis; Caenorhabditis elegans

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYDQGGEE ALQGGGGGGEGFHNPFDVFDMFFGGGGRGGRGERRVKPTVHNLRVTLDTLYKGVTKKLKISRTATCKGCK GLGGNEGSAKECSDCRGRGIKVRVIRMGPMVQQMQSHCDSCNGEGSTFLEKDRCKKCNGKKQVKEDEIIE VGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVRKGDNLIIQHNIDLSEALCGFVRTIS TLDGRTIFYRVLPGEVIAHADVKVIHNEGMPMRRASSDKGDLLVQFDVKFPDKINPDAAKKLADLLPGKR EEIIDEDAEVVELTELDPQASRRNFAERDDFEGHGGFGGHGHGPQGVQCQQS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGTGAAGGAAACAGGATATTATGACGTTCTCGGAGTAAAGCCGGATGCTTCAGACAATGAGTTGAAGAAGGCCTACCGTAAAATGGC
GCTCAAATTCCATCCAGACAAGAATCCAGACGGAGCTGAGCAATTCAAGCAGATCTCCCAGGCATACGAAGTATTATCAGATGAGAAGAA
ACGTCAGATTTATGATCAGGGTGGAGAAGAAGCACTTCAAGGCGGTGGTGGTGGCGGAGAGGGATTCCACAATCCGTTCGACGTATTCGA
CATGTTCTTCGGAGGCGGTGGTCGTGGTGGTCGTGGAGAACGTCGAGTAAAACCAACGGTTCACAATTTACGGGTCACACTCGACACACT
GTACAAGGGTGTTACGAAAAAGCTGAAAATCTCAAGAACTGCCACTTGTAAAGGATGCAAGGGACTTGGAGGCAACGAGGGATCCGCTAA
GGAGTGCTCTGATTGTCGTGGACGTGGAATCAAGGTTCGTGTTATCAGAATGGGACCAATGGTTCAACAAATGCAATCTCACTGCGACAG
TTGTAATGGAGAAGGCTCAACATTCCTTGAAAAAGATCGCTGCAAAAAGTGTAACGGAAAGAAGCAGGTGAAAGAAGACGAAATTATTGA
AGTTGGAATCACGCCTGGCATGAAAGATGGCGAGAAGTTTGTGTTCGAAGGAAAAGGAGACGAAGTGATCGGTATTGAGAAGCCTGGAGA
CTTTGTAGTTGTGCTCGACGAGGTTGAACACGAGAAATTCGTCCGAAAAGGCGATAATCTGATTATTCAACACAATATCGATCTTTCCGA
GGCTCTGTGCGGATTTGTGCGAACAATCAGTACACTTGATGGTCGAACAATTTTCTATCGTGTTCTTCCTGGAGAGGTTATTGCTCATGC
CGATGTTAAAGTGATCCACAACGAGGGAATGCCAATGCGTCGAGCATCATCTGATAAAGGAGATCTTCTCGTACAGTTCGATGTGAAATT
CCCCGATAAAATTAATCCAGATGCCGCGAAGAAGCTAGCCGATTTACTGCCTGGAAAGAGAGAAGAAATCATTGATGAAGACGCGGAAGT
CGTTGAGCTGACCGAGTTAGATCCACAAGCATCTCGCAGGAATTTCGCTGAGCGCGACGACTTTGAAGGACACGGTGGATTCGGTGGACA
TGGACACGGGCCACAAGGCGTTCAATGCCAACAGTCTTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine37031 %
Guanine33628 %
Thyamine27323 %
Cytosine23020 %
A+T64354 %
G+C56647 %

Total Bases :   1209 bases

Microsatellites
SequencePosition LengthRepeats
GGTGGTGGT22233
ACACAC35223
AGAGAG104523

Microsatellite Map

ATGGTGAAGGAAACAGGATATTATGACGTTCTCGGAGTAAAGCCGGATGCTTCAGACAATGAGTTGAAGAAGGCCTACCGTAAAATGGCG
CTCAAATTCCATCCAGACAAGAATCCAGACGGAGCTGAGCAATTCAAGCAGATCTCCCAGGCATACGAAGTATTATCAGATGAGAAGAAA
CGTCAGATTTATGATCAGGGTGGAGAAGAAGCACTTCAAGGCGGTGGTGGTGGCGGAGAGGGATTCCACAATCCGTTCGACGTATTCGAC
ATGTTCTTCGGAGGCGGTGGTCGTGGTGGTCGTGGAGAACGTCGAGTAAAACCAACGGTTCACAATTTACGGGTCACACTCGACACACTG
TACAAGGGTGTTACGAAAAAGCTGAAAATCTCAAGAACTGCCACTTGTAAAGGATGCAAGGGACTTGGAGGCAACGAGGGATCCGCTAAG
GAGTGCTCTGATTGTCGTGGACGTGGAATCAAGGTTCGTGTTATCAGAATGGGACCAATGGTTCAACAAATGCAATCTCACTGCGACAGT
TGTAATGGAGAAGGCTCAACATTCCTTGAAAAAGATCGCTGCAAAAAGTGTAACGGAAAGAAGCAGGTGAAAGAAGACGAAATTATTGAA
GTTGGAATCACGCCTGGCATGAAAGATGGCGAGAAGTTTGTGTTCGAAGGAAAAGGAGACGAAGTGATCGGTATTGAGAAGCCTGGAGAC
TTTGTAGTTGTGCTCGACGAGGTTGAACACGAGAAATTCGTCCGAAAAGGCGATAATCTGATTATTCAACACAATATCGATCTTTCCGAG
GCTCTGTGCGGATTTGTGCGAACAATCAGTACACTTGATGGTCGAACAATTTTCTATCGTGTTCTTCCTGGAGAGGTTATTGCTCATGCC
GATGTTAAAGTGATCCACAACGAGGGAATGCCAATGCGTCGAGCATCATCTGATAAAGGAGATCTTCTCGTACAGTTCGATGTGAAATTC
CCCGATAAAATTAATCCAGATGCCGCGAAGAAGCTAGCCGATTTACTGCCTGGAAAGAGAGAAGAAATCATTGATGAAGACGCGGAAGTC
GTTGAGCTGACCGAGTTAGATCCACAAGCATCTCGCAGGAATTTCGCTGAGCGCGACGACTTTGAAGGACACGGTGGATTCGGTGGACAT
GGACACGGGCCACAAGGCGTTCAATGCCAACAGTCTTGA

Gene Information
Molecule Type mRNA
Bases 1209 Bases
Molecular Weight375998.3 Da
Coding Sequence 1..1209
NCBI ReferenceNM_061169
Notes Caenorhabditis elegans Protein DNJ-12 (dnj-12) mRNA; complete cds. ProteinDNJ-12

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 6 to 65 60 N-terminal DnaJ domain PF00226
G/F-rich region 67 to 102 36 Glycine-phenylalanine rich region
Zinc-finger domain 136 to 201 66 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 259 to 342 84 Carboxy terminal domain PF01556

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2OCH Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_CAEL1

Accession Number

HSP40_2901

Added on

2012-02-02

Updated On

2014-01-20