Help  Custom Search
 
Putative tyrosine-protein phosphatase auxilin of Bos taurus

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Putative tyrosine-protein phosphatase auxilin

Synonymous Names

AUXI_BOVIN, HSP40 / J-protein, DnaJ

Gene names

Gene Name

DNAJC6

Gene Locus Tag

BOS_3437

Gene Identifier

317659

Taxon Information

Organism

Bos taurus

Organism ID

9913 [NCBI] [UNIPROT]

Lineage

Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos; Bos taurus

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MDSSGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGDLDFTYVTSRI IVMSFPLDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSLHNLFA VCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAVRLLYAKRPGIGLSPSHRRYLG YMCDLLADKPYRPHFKPLTIKSITVSPVPFFNKQRNGCRPYCDVLIGETKIYTTCADFERMKEYRVQDGK IFIPLSITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKY PQLFQVTLDVELQPHDKVMELTPPWEHYCTKDVNPSILFSSHQEHQDTLVLGGQAPIDIPPDNPRHFGQG GFFSTLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHAARKPSKKQQEPAAPAP PEDVDLLGLEGSAVSKNFSSPAAPPSNSELLSDLFGGGGAAGPVQSGQSGVDDVFHPSGPTSTQSTPRRS ATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTASASSDPFLQPTRSPSPTVHASSTPAVNIQP DVSGAWDWHTKPGGFGMGSKSAATSPTGSSHGTPTHQNKPQTLDPFADLGTLGGSSFASKPSTPTGLGGG FPPLSSPQKASPQPMGGGWQQGGGYNWQQTQSKPQSSMPHSSPQNRPNYNVSFSSMPGGQNERGKAAANL EGKQKAADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTV LWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY

FASTA Format Composition Secondary Structure

Nucleotide
 TCCTTGCAGCTGGTGGACAGTAACGGGGACCTAAGTGCGGGGAGCGGCGGGGGCGGCGGCAAACAGAGAGTGAACGCCGGGGCGGCAGC
GGCCGGAGTCCCGCCCGGCAGCCTCAGGACCGCGCCAGCACCATGGACAGCTCAGGTGCCTCATCTCCAGACATGGAGCCCAGCTATGGC
GGAGGTCTTTTTGACATGGTGAAAGGAGGGGCAGGGAGGCTCTTTAGCAACCTAAAGGACAACTTGAAAGACACTCTCAAAGACACGTCT
TCCAGAGTTATACAATCTGTTACCAGCTACACGAAAGGAGATTTAGACTTCACTTATGTTACCTCCAGAATTATTGTGATGTCCTTTCCT
CTGGACAGTGTTGACATAGGATTCAGGAATCAGGTTGATGATATTCGAAGCTTTTTGGATTCCAGACATCTTGACCACTACACGGTATAC
AATCTGTCGCCCAAGTCTTATCGAACTGCCAAGTTTCACAGCAGGGTCTCAGAATGCAGTTGGCCCATCAGGCAGGCCCCCAGCCTGCAC
AACCTCTTTGCTGTGTGTCGGAATATGTATAACTGGCTACTACAGAATCCCAAAAACGTCTGTGTTGTCCACTGCTTGGATGGACGGGCA
GCATCATCGATTCTGGTTGGTGCTATGTTCATTTTCTGTAATCTCTACTCTACTCCTGGCCCAGCCGTTCGATTGCTCTACGCAAAGCGA
CCAGGAATTGGACTTTCACCATCCCACAGGAGGTACCTGGGCTACATGTGTGACCTCCTAGCAGACAAACCCTACCGCCCTCACTTCAAG
CCTCTCACAATTAAGTCGATCACTGTCAGTCCAGTTCCTTTTTTCAACAAACAGAGAAATGGATGTCGCCCTTACTGCGATGTACTGATT
GGAGAAACCAAAATATATACAACCTGTGCAGATTTTGAACGAATGAAGGAATACCGTGTCCAAGATGGAAAAATCTTCATTCCTTTGAGC
ATCACTGTGCAAGGAGATGTGGTTGTTTCCATGTATCACTTGAGGTCAACAATTGGAAGCAGGCTACAGGCTAAGGTGACCAACACTCAA
ATATTTCAGCTTCAGTTTCATACTGGATTCATTCCACTGGACACAACAGTTTTAAAGTTCACCAAGCCTGAGTTGGATGCATGTGATGTA
CCAGAAAAATATCCTCAGCTATTTCAGGTAACTCTGGATGTAGAACTACAGCCTCACGACAAAGTGATGGAGCTAACCCCACCGTGGGAA
CATTACTGCACAAAAGATGTCAACCCCAGCATCCTCTTCTCTTCTCACCAGGAGCATCAAGATACTCTGGTCTTAGGAGGACAGGCTCCA
ATAGATATCCCTCCAGATAATCCCAGACATTTTGGGCAAGGTGGCTTCTTTTCCACTCTCTGCTGGCAAGATCAGAAATCGGAGAAGTCA
TTCTGCGAGGAGGACCACGCTGCCCTAGTGAATCAGGAGAGTGAGCAGTCAGACGATGAGCTTCTGACGCTGTCCAGCCCACATGGCAAT
GCCAATGGTGACAAACCTCACGCAGCCAGGAAGCCCAGCAAAAAGCAGCAGGAGCCAGCTGCCCCTGCACCCCCTGAGGATGTGGATCTT
CTGGGTCTAGAAGGGTCTGCTGTGAGTAAGAACTTCTCTTCGCCGGCAGCTCCTCCCTCCAATTCCGAACTTCTGAGTGACCTGTTCGGG
GGCGGAGGTGCAGCCGGTCCCGTCCAGTCTGGACAGTCAGGGGTGGACGACGTGTTTCACCCGAGTGGACCTACATCCACCCAGTCCACA
CCACGCCGATCTGCCACCTCCACCTCTGCATCTCCAACACTGAGAGTAGGAGAAGGTGCCACCTTTGACCCATTTGGAGCACCTTCTAAA
CCATCAGGTCAAGATTTGCTGGGTTCTTTTTTGAACACAGCCAGTGCTTCCAGTGACCCCTTTCTTCAGCCTACGAGGAGTCCTTCTCCT
ACAGTGCATGCTTCTAGTACCCCTGCTGTGAACATTCAGCCAGATGTTTCAGGAGCCTGGGACTGGCATACCAAACCAGGAGGTTTTGGA
ATGGGAAGCAAATCAGCTGCCACCAGCCCAACAGGCTCCTCGCATGGTACTCCCACCCATCAAAACAAACCCCAGACTCTGGACCCTTTT
GCTGACCTTGGGACATTAGGTGGTTCTTCATTTGCCAGCAAACCTTCCACACCAACTGGATTGGGTGGTGGATTTCCACCTCTCAGCTCG
CCACAGAAAGCATCTCCCCAGCCCATGGGTGGGGGGTGGCAGCAGGGAGGGGGCTACAACTGGCAGCAGACACAGTCCAAGCCACAGTCC
AGCATGCCCCACTCCTCTCCCCAGAACCGGCCCAACTACAACGTGAGCTTCTCATCCATGCCTGGGGGCCAGAACGAACGTGGGAAAGCA
GCAGCTAATTTGGAGGGGAAACAAAAAGCAGCTGACTTTGAAGACCTGCTCTCTGGTCAAGGTTTTAATGCTCACAAAGACAAAAAGGGA
CCTCGAACAATAGCTGAGATGAGAAAGGAGGAAATGGCTAAGGAGATGGATCCTGAGAAGTTAAAGATTCTAGAATGGATTGAAGGCAAA
GAGAGGAATATCAGAGCCCTTCTGTCCACAATGCACACTGTGCTGTGGGCTGGGGAGACTAAGTGGAAACCTGTTGGCATGGCAGACCTG
GTCACCCCGGAGCAGGTGAAGAAGGTGTACAGGAAGGCTGTGCTAGTGGTGCACCCGGATAAAGCTACTGGGCAACCCTATGAACAATAT
GCAAAGATGATTTTCATGGAGCTCAATGATGCCTGGTCAGAATTTGAAAATCAAGGCCAAAAGCCCTTGTATTAACTTATGAGCTTTTCC
ATTTCTGCTGCAGACCCGTGCTAATGCTTAGTGTGTGTCACAGTTCTGAGGTTTTTGCAGGTGAACCAAAAACTCCAGCAATGTGTATCC
AGTACTTAACTGTTAAGTTACTTGTGAATTAATTCCTCTTTAATAAGGAATGTGGATGTTTGTTTTCTCAAGTCCCCACCATAAAAAGTC
CAAAACAGGAAAGGAACTTTTAGTCAGATGACCTTGCAGAGTATTTTTACAACATTCCAGCCTGCCCTGTGGAGCCTACTCAGCAATTTG
TGGGGAAATTGAAAATAAAGGCTACCAAAGGCATAGCACCCATCTCATTGTCTGAGGATAGGATAATGAGCCAAAGTTATAATAATAGGA
TTACATGATGGATTTTAACTAATAGTTTTGAGATTTTCTTGGAAAGATAAAATTTGAGCCATGGCTTTACGTAGACTTCAGGAACATGAC
CATTAAGTTTTGTTTGTTTGTTTGTTTTAACAGAAATTTACTATGGTCTATAGTATAATACTGTACACTTCTTTTGGTCAAGAGGACTAA
CAGATGTAAAAGAACCTGAACTGTGGGAAGTAATTCTATTATAATCCAGTGATTACTACCAACACTTCCTTCCTGGATAAGCTAAAATTT
AGTGAAAATGCTGACTGAAGAAAAATAGGGACGCTAAAGCTGTAGAAATCTGTATTCCGGTCAGAGAGTTGGGCTACTATCTTCTTTTCC
CTTTAGAAAGATGTGGTAGCTTGAAGAAGTGCTTAATGCCATAACAACAACCTGATTTGATGAAACTTCTAATTTTTCCTGTAAGGCTTA
ATGCTCCTCCTTTTTCTTAGCAGAGAAAATGCTCTTAGCTGGGAACAGATTGTAAGGCAGTTTGGCGTGTTCACAGTTGACAGGAAGACT
GTCTAGTATGGATCCCCTGTCCTCCAGGTTTGTGATTGGCTGGGGAAAGGAAATCGATGACCACAGTGACAGGGGCAATTGCAGCGAGAG
ACAGAGAGAGGCCACTTCAGACCAAGTCACATGGCTTATCAAGACTGGCTTCTCTGAGGAACCAGGTTCTCTTCCCACCTGATGAAATAG
GACCTCTTGGATTATTACAGTGGGGTTTATTGTTCTAAAAGTTGTTGGGGGTCCACAGGAATAACAGTTGCACAGGAACGTCTGTGAAAA
TAAAGCAGGAGTGAAACCTTTGCAGACTTCAGACTGGTTGGATTTCAGTTCAGTATTTTGGCTGTTTCTCACTTTAAGGGGCAAGTGATT
GTTTTCCATGACTTTGGTAGATCTCTTTGGGTGTGCAGGTACACGGTGTGCAGAGGATATTCATACAAGGCAGATGCGCAGAAAGATCTT
GATCTAATCTTAAAAGGTTTGTGCTCAGTATTGTGAAAAGCTTTCAAAAATTGTTTCTAAAAGACAATCCTTTTTGTTGTTTCTTTCTGT
TTTTCATTTTCTTGTGGCAAACTGTACTGGAAAAGCAGCATGTCAAAAATACTTTATGTTCTATATACAACTCTCTTCTTTCTTTCTCTC
TTTCTTCCTTTCTTTCCTTCATTCTTTTTTTTGTTGTTGTTATAAAGGTTCATTATTTATTTTACCTTTTGCTGACAATGTGAAACTCGC
CTCAAATATTCTCTTTTTAAATATACAGCTGC 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine122428 %
Guanine105424 %
Thyamine120527 %
Cytosine104824 %
A+T242954 %
G+C210247 %

Total Bases :   4531 bases

Microsatellites
SequencePosition LengthRepeats
GGCGGCGGC5133
AGAGAG6423
TGTGTG55023
TGTGTG76523
TTTTTT84723
ATATAT91123
CTCTCT140423
TTTTTT191523
GGGGGG227923
AGCAGCAGC242533
CTCTCT247723
AGAGAG260823
GTGTGTGT290924
ATAATAATA322733
TTTGTTTGTTTGTTTG333744
AGAGAG357123
AACAACAAC364133
GAGAGA386423
AGAGAGAG387124
TATATA438023
CTCTCT438923
TCTCTC440323
TTTTTTTT443324
GTTGTTGTT444133

Microsatellite Map

TCCTTGCAGCTGGTGGACAGTAACGGGGACCTAAGTGCGGGGAGCGGCGGGGGCGGCGGCAAACAGAGAGTGAACGCCGGGGCGGCAGCG
GCCGGAGTCCCGCCCGGCAGCCTCAGGACCGCGCCAGCACCATGGACAGCTCAGGTGCCTCATCTCCAGACATGGAGCCCAGCTATGGCG
GAGGTCTTTTTGACATGGTGAAAGGAGGGGCAGGGAGGCTCTTTAGCAACCTAAAGGACAACTTGAAAGACACTCTCAAAGACACGTCTT
CCAGAGTTATACAATCTGTTACCAGCTACACGAAAGGAGATTTAGACTTCACTTATGTTACCTCCAGAATTATTGTGATGTCCTTTCCTC
TGGACAGTGTTGACATAGGATTCAGGAATCAGGTTGATGATATTCGAAGCTTTTTGGATTCCAGACATCTTGACCACTACACGGTATACA
ATCTGTCGCCCAAGTCTTATCGAACTGCCAAGTTTCACAGCAGGGTCTCAGAATGCAGTTGGCCCATCAGGCAGGCCCCCAGCCTGCACA
ACCTCTTTGCTGTGTGTCGGAATATGTATAACTGGCTACTACAGAATCCCAAAAACGTCTGTGTTGTCCACTGCTTGGATGGACGGGCAG
CATCATCGATTCTGGTTGGTGCTATGTTCATTTTCTGTAATCTCTACTCTACTCCTGGCCCAGCCGTTCGATTGCTCTACGCAAAGCGAC
CAGGAATTGGACTTTCACCATCCCACAGGAGGTACCTGGGCTACATGTGTGACCTCCTAGCAGACAAACCCTACCGCCCTCACTTCAAGC
CTCTCACAATTAAGTCGATCACTGTCAGTCCAGTTCCTTTTTTCAACAAACAGAGAAATGGATGTCGCCCTTACTGCGATGTACTGATTG
GAGAAACCAAAATATATACAACCTGTGCAGATTTTGAACGAATGAAGGAATACCGTGTCCAAGATGGAAAAATCTTCATTCCTTTGAGCA
TCACTGTGCAAGGAGATGTGGTTGTTTCCATGTATCACTTGAGGTCAACAATTGGAAGCAGGCTACAGGCTAAGGTGACCAACACTCAAA
TATTTCAGCTTCAGTTTCATACTGGATTCATTCCACTGGACACAACAGTTTTAAAGTTCACCAAGCCTGAGTTGGATGCATGTGATGTAC
CAGAAAAATATCCTCAGCTATTTCAGGTAACTCTGGATGTAGAACTACAGCCTCACGACAAAGTGATGGAGCTAACCCCACCGTGGGAAC
ATTACTGCACAAAAGATGTCAACCCCAGCATCCTCTTCTCTTCTCACCAGGAGCATCAAGATACTCTGGTCTTAGGAGGACAGGCTCCAA
TAGATATCCCTCCAGATAATCCCAGACATTTTGGGCAAGGTGGCTTCTTTTCCACTCTCTGCTGGCAAGATCAGAAATCGGAGAAGTCAT
TCTGCGAGGAGGACCACGCTGCCCTAGTGAATCAGGAGAGTGAGCAGTCAGACGATGAGCTTCTGACGCTGTCCAGCCCACATGGCAATG
CCAATGGTGACAAACCTCACGCAGCCAGGAAGCCCAGCAAAAAGCAGCAGGAGCCAGCTGCCCCTGCACCCCCTGAGGATGTGGATCTTC
TGGGTCTAGAAGGGTCTGCTGTGAGTAAGAACTTCTCTTCGCCGGCAGCTCCTCCCTCCAATTCCGAACTTCTGAGTGACCTGTTCGGGG
GCGGAGGTGCAGCCGGTCCCGTCCAGTCTGGACAGTCAGGGGTGGACGACGTGTTTCACCCGAGTGGACCTACATCCACCCAGTCCACAC
CACGCCGATCTGCCACCTCCACCTCTGCATCTCCAACACTGAGAGTAGGAGAAGGTGCCACCTTTGACCCATTTGGAGCACCTTCTAAAC
CATCAGGTCAAGATTTGCTGGGTTCTTTTTTGAACACAGCCAGTGCTTCCAGTGACCCCTTTCTTCAGCCTACGAGGAGTCCTTCTCCTA
CAGTGCATGCTTCTAGTACCCCTGCTGTGAACATTCAGCCAGATGTTTCAGGAGCCTGGGACTGGCATACCAAACCAGGAGGTTTTGGAA
TGGGAAGCAAATCAGCTGCCACCAGCCCAACAGGCTCCTCGCATGGTACTCCCACCCATCAAAACAAACCCCAGACTCTGGACCCTTTTG
CTGACCTTGGGACATTAGGTGGTTCTTCATTTGCCAGCAAACCTTCCACACCAACTGGATTGGGTGGTGGATTTCCACCTCTCAGCTCGC
CACAGAAAGCATCTCCCCAGCCCATGGGTGGGGGGTGGCAGCAGGGAGGGGGCTACAACTGGCAGCAGACACAGTCCAAGCCACAGTCCA
GCATGCCCCACTCCTCTCCCCAGAACCGGCCCAACTACAACGTGAGCTTCTCATCCATGCCTGGGGGCCAGAACGAACGTGGGAAAGCAG
CAGCTAATTTGGAGGGGAAACAAAAAGCAGCTGACTTTGAAGACCTGCTCTCTGGTCAAGGTTTTAATGCTCACAAAGACAAAAAGGGAC
CTCGAACAATAGCTGAGATGAGAAAGGAGGAAATGGCTAAGGAGATGGATCCTGAGAAGTTAAAGATTCTAGAATGGATTGAAGGCAAAG
AGAGGAATATCAGAGCCCTTCTGTCCACAATGCACACTGTGCTGTGGGCTGGGGAGACTAAGTGGAAACCTGTTGGCATGGCAGACCTGG
TCACCCCGGAGCAGGTGAAGAAGGTGTACAGGAAGGCTGTGCTAGTGGTGCACCCGGATAAAGCTACTGGGCAACCCTATGAACAATATG
CAAAGATGATTTTCATGGAGCTCAATGATGCCTGGTCAGAATTTGAAAATCAAGGCCAAAAGCCCTTGTATTAACTTATGAGCTTTTCCA
TTTCTGCTGCAGACCCGTGCTAATGCTTAGTGTGTGTCACAGTTCTGAGGTTTTTGCAGGTGAACCAAAAACTCCAGCAATGTGTATCCA
GTACTTAACTGTTAAGTTACTTGTGAATTAATTCCTCTTTAATAAGGAATGTGGATGTTTGTTTTCTCAAGTCCCCACCATAAAAAGTCC
AAAACAGGAAAGGAACTTTTAGTCAGATGACCTTGCAGAGTATTTTTACAACATTCCAGCCTGCCCTGTGGAGCCTACTCAGCAATTTGT
GGGGAAATTGAAAATAAAGGCTACCAAAGGCATAGCACCCATCTCATTGTCTGAGGATAGGATAATGAGCCAAAGTTATAATAATAGGAT
TACATGATGGATTTTAACTAATAGTTTTGAGATTTTCTTGGAAAGATAAAATTTGAGCCATGGCTTTACGTAGACTTCAGGAACATGACC
ATTAAGTTTTGTTTGTTTGTTTGTTTTAACAGAAATTTACTATGGTCTATAGTATAATACTGTACACTTCTTTTGGTCAAGAGGACTAAC
AGATGTAAAAGAACCTGAACTGTGGGAAGTAATTCTATTATAATCCAGTGATTACTACCAACACTTCCTTCCTGGATAAGCTAAAATTTA
GTGAAAATGCTGACTGAAGAAAAATAGGGACGCTAAAGCTGTAGAAATCTGTATTCCGGTCAGAGAGTTGGGCTACTATCTTCTTTTCCC
TTTAGAAAGATGTGGTAGCTTGAAGAAGTGCTTAATGCCATAACAACAACCTGATTTGATGAAACTTCTAATTTTTCCTGTAAGGCTTAA
TGCTCCTCCTTTTTCTTAGCAGAGAAAATGCTCTTAGCTGGGAACAGATTGTAAGGCAGTTTGGCGTGTTCACAGTTGACAGGAAGACTG
TCTAGTATGGATCCCCTGTCCTCCAGGTTTGTGATTGGCTGGGGAAAGGAAATCGATGACCACAGTGACAGGGGCAATTGCAGCGAGAGA
CAGAGAGAGGCCACTTCAGACCAAGTCACATGGCTTATCAAGACTGGCTTCTCTGAGGAACCAGGTTCTCTTCCCACCTGATGAAATAGG
ACCTCTTGGATTATTACAGTGGGGTTTATTGTTCTAAAAGTTGTTGGGGGTCCACAGGAATAACAGTTGCACAGGAACGTCTGTGAAAAT
AAAGCAGGAGTGAAACCTTTGCAGACTTCAGACTGGTTGGATTTCAGTTCAGTATTTTGGCTGTTTCTCACTTTAAGGGGCAAGTGATTG
TTTTCCATGACTTTGGTAGATCTCTTTGGGTGTGCAGGTACACGGTGTGCAGAGGATATTCATACAAGGCAGATGCGCAGAAAGATCTTG
ATCTAATCTTAAAAGGTTTGTGCTCAGTATTGTGAAAAGCTTTCAAAAATTGTTTCTAAAAGACAATCCTTTTTGTTGTTTCTTTCTGTT
TTTCATTTTCTTGTGGCAAACTGTACTGGAAAAGCAGCATGTCAAAAATACTTTATGTTCTATATACAACTCTCTTCTTTCTTTCTCTCT
TTCTTCCTTTCTTTCCTTCATTCTTTTTTTTGTTGTTGTTATAAAGGTTCATTATTTATTTTACCTTTTGCTGACAATGTGAAACTCGCC
TCAAATATTCTCTTTTTAAATATACAGCTGC

Gene Information
Molecule Type mRNA
Bases 4531 Bases
Molecular Weight1399916.06 Da
Coding Sequence 132..2864
NCBI ReferenceNM_174836
Notes Bos taurus DnaJ (Hsp40) homolog; subfamily C; member 6 (DNAJC6);mRNA. putativetyrosine-proteinphosphataseauxilin

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
PTEN_C2 223 to 362 140 C2 domain of PTEN tumour-suppressor protein PF10409
J-domain 852 to 910 59 N-terminal DnaJ domain PF00226

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

1N4C Jmol
1NZ6 Jmol
1Q2G Jmol
1XI5 Jmol
2QWN Jmol
2QWO Jmol
2GWP Jmol
2QWQ Jmol
2QWR Jmol
3N0A Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_BOTA40

Accession Number

HSP40_2854

Added on

2012-02-02

Updated On

2014-01-20