Help  Custom Search
 
Chaperone protein DnaJ of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein DnaJ

Synonymous Names

DNAJ_ACIB5, Hsp40/J-protein, DnaJ

Gene names

Gene Name

dnaJ

Gene Locus Tag

AB57_3901

Gene Identifier

7046958

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii complex; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEASEAYEILSDSEKRSMYDRMG HNAFEGGFGGAGGGFGGFSAEDIFSQFGDIFGGAFGGGGRQQRQRRGSDLRYVMELTLEEAVKGVKKTIT FTAPAPCDVCDGKGSKNPKDVETCKTCHGSGQVRMQQGFFSVQQTCGTCRGQGKIIKNPCHACHGSGVAD RQQTLEVTIPAGVDNGDRVRLSGKGEAIRDGQAGDLYVEVVVREHEIFQRDGADLYMDVPVSIADAALGK EIEIPTLEGRVSLKIPEGTQTGKLFRLRGKGVRPVRSSMVGDLLCRIVVETPVNLTSRQRELLKELQASF DGEDSASSPKKKSFFDRLFD

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCTAAACGTGATTATTATGAGGTTTTAGGCGTTTCAAAAACCGCAAGTGATGATGAGATCAAAAAAGCCTATCGTAAATTGGCGAT
GAAATATCATCCTGACAGAAACCCTGACAATGCCGAGGCTGAAGAAAAATTTAAAGAAGCTTCTGAAGCTTATGAGATTTTATCGGACAG
CGAAAAACGCAGCATGTATGACCGTATGGGACATAATGCGTTTGAAGGCGGCTTTGGTGGCGCTGGTGGTGGCTTTGGCGGTTTCAGTGC
AGAAGATATTTTTAGCCAGTTCGGTGATATCTTTGGTGGAGCGTTTGGTGGCGGCGGACGTCAGCAACGCCAACGTCGCGGTTCAGATTT
ACGCTATGTCATGGAACTTACCCTTGAGGAAGCTGTAAAAGGGGTTAAAAAAACAATTACCTTTACTGCTCCAGCACCATGTGATGTGTG
TGATGGTAAAGGCTCTAAAAATCCAAAAGATGTAGAAACTTGTAAAACTTGTCACGGTTCAGGACAAGTGCGTATGCAGCAAGGTTTCTT
CTCTGTACAACAAACTTGTGGCACATGTCGTGGCCAAGGCAAAATTATTAAAAACCCATGCCATGCATGTCATGGTTCAGGTGTAGCAGA
TCGTCAGCAAACATTAGAAGTGACGATTCCTGCAGGTGTGGACAATGGTGACCGCGTTCGTTTAAGTGGTAAAGGCGAGGCTATTCGTGA
TGGTCAAGCTGGTGACTTATACGTTGAAGTGGTTGTTCGTGAACACGAAATTTTCCAACGTGATGGTGCCGACTTATATATGGACGTACC
AGTAAGCATTGCTGATGCTGCACTTGGTAAAGAAATTGAAATCCCGACTTTGGAAGGCCGAGTTAGCTTGAAGATTCCTGAGGGAACTCA
AACAGGTAAATTATTCCGTTTACGTGGTAAAGGTGTGCGCCCTGTACGTAGCAGTATGGTGGGTGATTTACTTTGCCGTATCGTGGTAGA
AACACCGGTTAACCTAACCTCTCGTCAACGTGAATTACTTAAAGAATTACAAGCATCTTTCGATGGTGAAGACAGTGCTTCTTCACCAAA
GAAAAAATCTTTCTTTGATCGCTTATTCGATTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine32029 %
Guanine28426 %
Thyamine30728 %
Cytosine20219 %
A+T62757 %
G+C48644 %

Total Bases :   1113 bases

Microsatellites
SequencePosition LengthRepeats
TGATGATGA5033
AAAAAA6323
TGGTGGTGG24233
AAAAAA40523
TGTGTGTG44324
TATATA79323
AAAAAA108023

Microsatellite Map

ATGGCTAAACGTGATTATTATGAGGTTTTAGGCGTTTCAAAAACCGCAAGTGATGATGAGATCAAAAAAGCCTATCGTAAATTGGCGATG
AAATATCATCCTGACAGAAACCCTGACAATGCCGAGGCTGAAGAAAAATTTAAAGAAGCTTCTGAAGCTTATGAGATTTTATCGGACAGC
GAAAAACGCAGCATGTATGACCGTATGGGACATAATGCGTTTGAAGGCGGCTTTGGTGGCGCTGGTGGTGGCTTTGGCGGTTTCAGTGCA
GAAGATATTTTTAGCCAGTTCGGTGATATCTTTGGTGGAGCGTTTGGTGGCGGCGGACGTCAGCAACGCCAACGTCGCGGTTCAGATTTA
CGCTATGTCATGGAACTTACCCTTGAGGAAGCTGTAAAAGGGGTTAAAAAAACAATTACCTTTACTGCTCCAGCACCATGTGATGTGTGT
GATGGTAAAGGCTCTAAAAATCCAAAAGATGTAGAAACTTGTAAAACTTGTCACGGTTCAGGACAAGTGCGTATGCAGCAAGGTTTCTTC
TCTGTACAACAAACTTGTGGCACATGTCGTGGCCAAGGCAAAATTATTAAAAACCCATGCCATGCATGTCATGGTTCAGGTGTAGCAGAT
CGTCAGCAAACATTAGAAGTGACGATTCCTGCAGGTGTGGACAATGGTGACCGCGTTCGTTTAAGTGGTAAAGGCGAGGCTATTCGTGAT
GGTCAAGCTGGTGACTTATACGTTGAAGTGGTTGTTCGTGAACACGAAATTTTCCAACGTGATGGTGCCGACTTATATATGGACGTACCA
GTAAGCATTGCTGATGCTGCACTTGGTAAAGAAATTGAAATCCCGACTTTGGAAGGCCGAGTTAGCTTGAAGATTCCTGAGGGAACTCAA
ACAGGTAAATTATTCCGTTTACGTGGTAAAGGTGTGCGCCCTGTACGTAGCAGTATGGTGGGTGATTTACTTTGCCGTATCGTGGTAGAA
ACACCGGTTAACCTAACCTCTCGTCAACGTGAATTACTTAAAGAATTACAAGCATCTTTCGATGGTGAAGACAGTGCTTCTTCACCAAAG
AAAAAATCTTTCTTTGATCGCTTATTCGATTAA

Gene Information
Molecule Type genomic DNA
Bases 1113 Bases
Molecular Weight345464.64 Da
Coding Sequence complement(CP001182.1:4021679..4022791)
NCBI ReferenceACJ42829
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 5 to 67 63 N-terminal DnaJ domain PF00226
G/F-rich region 74 to 109 36 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 134 to 214 81 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 227 to 347 121 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACBA1

Accession Number

HSP40_0025

Added on

2012-02-02

Updated On

2014-01-20