Help  Custom Search
 
Chaperone protein DnaJ of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein DnaJ

Synonymous Names

A0LSZ7_ACIC1, Hsp40/J-protein, Chaperone protein dnaJ 1, DnaJ

Gene names

Gene Name

dnaJ1

Gene Locus Tag

Acel_0784

Gene Identifier

4486218

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MAKDHYATLGVRRDATQEEIKRAYRRLARQLHPDVNPDPETQERFKEINAAYEVLSDPEKRRIYDMGGDP LSPNGGYAGGPFGDFGFGGLSDLMDAFFGTATRGPRSRVRRGSDALIHVQVDLADVIFGATREVTVDTAV VCPTCTGAGTAPGTHPDTCPMCRGRGEISHVTRSFLGQMMTTRPCPQCGGVGTVIRHPCPECAGDGRIRA RRTLEVVIPPGVEHGVRLHLAGEGEVGPGGGPAGDLYVEIEERRHPVFRRDGTDLHATLQIPMTAAALGT TLTLETFDGPVEIDVKPGTQSGTVIVLKGRGVPRLRGSGRGDLHVHLEVLTPTKLDAEQEALLRKLAALR GEEIVDGAFKSDQPGFFSRIRDAFNGR

FASTA Format Composition Secondary Structure

Nucleotide
 GTGGCTAAGGACCACTACGCCACTCTCGGGGTACGCCGCGACGCCACCCAGGAAGAGATCAAACGGGCGTATCGCCGTCTTGCCCGGCA
GTTGCATCCGGACGTCAATCCCGATCCAGAGACCCAGGAGCGGTTCAAAGAGATCAATGCTGCCTATGAAGTGCTGTCGGATCCGGAGAA
ACGCCGGATTTACGACATGGGCGGCGATCCGCTCTCCCCGAACGGCGGTTACGCCGGCGGGCCGTTCGGTGACTTCGGATTCGGCGGTCT
CTCCGACTTGATGGACGCCTTCTTTGGGACGGCGACCCGCGGTCCGCGGAGCCGGGTCCGGCGGGGCAGTGACGCGCTCATCCACGTGCA
GGTCGACCTTGCGGACGTCATCTTTGGTGCGACCCGGGAGGTAACGGTCGACACCGCCGTCGTCTGCCCGACCTGCACCGGCGCGGGGAC
AGCGCCCGGCACGCATCCGGACACCTGCCCGATGTGCCGCGGCCGCGGGGAAATCAGTCACGTCACCCGGTCTTTCCTCGGCCAGATGAT
GACCACCCGACCCTGCCCGCAATGCGGGGGTGTCGGCACGGTGATCCGTCATCCCTGCCCGGAGTGCGCCGGCGACGGCCGCATCCGGGC
CCGGCGCACGTTGGAGGTCGTCATCCCACCGGGTGTCGAGCACGGTGTCCGGCTGCACCTCGCCGGTGAGGGCGAGGTGGGTCCCGGCGG
AGGACCGGCCGGGGATCTGTACGTCGAGATCGAGGAGCGCCGTCACCCGGTTTTCCGGCGGGACGGGACCGACCTGCACGCCACCCTGCA
GATTCCGATGACCGCCGCGGCGCTCGGGACCACACTGACCCTGGAAACCTTCGATGGGCCGGTGGAGATCGACGTCAAACCCGGCACTCA
GTCGGGCACGGTCATCGTGCTCAAAGGCAGGGGCGTCCCGCGGCTCCGCGGTTCCGGGCGTGGCGACCTGCACGTGCACCTGGAGGTTCT
CACCCCGACGAAATTGGACGCCGAACAAGAAGCGCTGCTGCGCAAGCTCGCCGCGTTGCGCGGCGAAGAAATCGTCGACGGTGCGTTCAA
ATCCGACCAGCCGGGGTTCTTCTCCCGGATCCGGGATGCGTTCAACGGTCGCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine18617 %
Guanine38635 %
Thyamine18116 %
Cytosine38134 %
A+T36733 %
G+C76768 %

Total Bases :   1134 bases

Microsatellites
SequencePosition LengthRepeats
TCTCTC26623

Microsatellite Map

GTGGCTAAGGACCACTACGCCACTCTCGGGGTACGCCGCGACGCCACCCAGGAAGAGATCAAACGGGCGTATCGCCGTCTTGCCCGGCAG
TTGCATCCGGACGTCAATCCCGATCCAGAGACCCAGGAGCGGTTCAAAGAGATCAATGCTGCCTATGAAGTGCTGTCGGATCCGGAGAAA
CGCCGGATTTACGACATGGGCGGCGATCCGCTCTCCCCGAACGGCGGTTACGCCGGCGGGCCGTTCGGTGACTTCGGATTCGGCGGTCTC
TCCGACTTGATGGACGCCTTCTTTGGGACGGCGACCCGCGGTCCGCGGAGCCGGGTCCGGCGGGGCAGTGACGCGCTCATCCACGTGCAG
GTCGACCTTGCGGACGTCATCTTTGGTGCGACCCGGGAGGTAACGGTCGACACCGCCGTCGTCTGCCCGACCTGCACCGGCGCGGGGACA
GCGCCCGGCACGCATCCGGACACCTGCCCGATGTGCCGCGGCCGCGGGGAAATCAGTCACGTCACCCGGTCTTTCCTCGGCCAGATGATG
ACCACCCGACCCTGCCCGCAATGCGGGGGTGTCGGCACGGTGATCCGTCATCCCTGCCCGGAGTGCGCCGGCGACGGCCGCATCCGGGCC
CGGCGCACGTTGGAGGTCGTCATCCCACCGGGTGTCGAGCACGGTGTCCGGCTGCACCTCGCCGGTGAGGGCGAGGTGGGTCCCGGCGGA
GGACCGGCCGGGGATCTGTACGTCGAGATCGAGGAGCGCCGTCACCCGGTTTTCCGGCGGGACGGGACCGACCTGCACGCCACCCTGCAG
ATTCCGATGACCGCCGCGGCGCTCGGGACCACACTGACCCTGGAAACCTTCGATGGGCCGGTGGAGATCGACGTCAAACCCGGCACTCAG
TCGGGCACGGTCATCGTGCTCAAAGGCAGGGGCGTCCCGCGGCTCCGCGGTTCCGGGCGTGGCGACCTGCACGTGCACCTGGAGGTTCTC
ACCCCGACGAAATTGGACGCCGAACAAGAAGCGCTGCTGCGCAAGCTCGCCGCGTTGCGCGGCGAAGAAATCGTCGACGGTGCGTTCAAA
TCCGACCAGCCGGGGTTCTTCTCCCGGATCCGGGATGCGTTCAACGGTCGCTGA

Gene Information
Molecule Type genomic DNA
Bases 1134 Bases
Molecular Weight350507.94 Da
Coding Sequence CP000481.1:866022..867155
NCBI ReferenceABK52557
NotesTIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 4 to 65 62 N-terminal DnaJ domain PF00226
G/F-rich region 75 to 99 25 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 129 to 213 85 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 226 to 347 122 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCE2

Accession Number

HSP40_0024

Added on

2012-02-02

Updated On

2014-01-20