Help  Custom Search
 
Chaperone protein DnaJ of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein DnaJ

Synonymous Names

A0LWS9_ACIC1, Hsp40/J-protein, DnaJ

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MHAHPTTRMSARDYIEKDYYKVLGVPKDASIDEIKKAYRKLARQYHPDANKGDPKAEERFKEISEAYDVL SDEKKRKEYDEARSLFGSGGFRIPTGSGTGTTGGFPFDLGDLFGGLRTGGLGDILGGIFGGGSRRAQPRR GADVETEITISFTDAIRGVTVPIRLTSPGPCPSCHGTGARAGTMPRVCPNCSGTGMVSRVVGGFALSEPC RECRGRGLVVDDPCPSCRGSGRATSERTLQVRIPAGVDDGQRIRLKGRGAPGENGGPAGDLIVLVHVQPH KVFGRSGPNLTLTLPVTFPEAALGATIEVPTLDGPVTVKLPPGTSSGRVLRVRGKGAPRRDGSRGDLLVT VEVVVPKKLSSKAREALEAFRSATEDENPRAGLLVGS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCACGCCCATCCGACAACGAGGATGAGCGCCCGCGACTACATCGAGAAGGACTACTACAAGGTCCTCGGCGTCCCTAAGGACGCGTC
CATCGACGAAATCAAGAAGGCATACCGGAAACTGGCCCGCCAGTATCATCCGGATGCCAACAAGGGCGACCCGAAGGCCGAGGAGCGGTT
CAAGGAGATTTCGGAAGCCTACGACGTTCTCTCCGACGAGAAGAAGCGCAAGGAGTACGACGAAGCGCGCTCGCTCTTCGGCAGCGGCGG
ATTCCGCATCCCCACCGGCTCCGGCACCGGCACGACCGGAGGTTTCCCGTTCGACCTGGGTGACCTCTTCGGTGGGCTGCGCACCGGAGG
CTTGGGCGACATTCTCGGCGGAATTTTCGGCGGCGGATCGCGGCGTGCCCAGCCGCGGCGCGGCGCGGACGTCGAGACCGAAATCACCAT
CAGCTTCACCGACGCGATTCGTGGTGTCACGGTGCCGATCCGGCTCACCAGCCCGGGACCGTGTCCGAGTTGTCACGGGACCGGAGCCCG
TGCCGGCACCATGCCGCGCGTCTGCCCGAACTGTTCGGGTACCGGCATGGTGTCCCGGGTGGTCGGCGGTTTCGCGCTGTCCGAACCATG
CCGGGAGTGTCGCGGCCGGGGTCTCGTCGTCGATGACCCCTGCCCGAGCTGCCGGGGCAGCGGCCGGGCGACGAGCGAGCGCACGCTGCA
GGTGCGCATTCCCGCCGGTGTTGACGACGGCCAGCGCATCCGGCTCAAGGGGCGCGGCGCTCCCGGTGAGAACGGTGGACCGGCGGGCGA
CCTTATCGTCCTCGTGCATGTCCAACCGCACAAGGTCTTTGGCCGGTCCGGGCCGAACCTCACCCTCACGCTGCCGGTGACGTTCCCCGA
GGCGGCGCTCGGCGCGACGATCGAGGTTCCGACGCTCGATGGGCCGGTGACCGTGAAGTTGCCGCCTGGGACGTCCAGCGGCCGTGTCCT
GCGGGTGCGCGGCAAAGGCGCGCCACGCCGGGACGGCAGCCGCGGGGATCTGCTCGTCACCGTGGAGGTCGTCGTACCGAAGAAGCTGTC
GAGCAAAGCCCGCGAGGCACTGGAAGCGTTCCGGAGTGCGACCGAGGACGAGAATCCCCGGGCCGGATTGCTGGTCGGCAGCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine19617 %
Guanine40936 %
Thyamine17516 %
Cytosine38433 %
A+T37132 %
G+C79369 %

Total Bases :   1164 bases

Microsatellites
SequencePosition LengthRepeats
TCTCTC20623
GCGCGC24323
CGGCGGCGG38633
CGCGGCGCGGCGCGG41253
CGCGCG55323
TCGTCGTCG65233
GCGCGC100623

Microsatellite Map

ATGCACGCCCATCCGACAACGAGGATGAGCGCCCGCGACTACATCGAGAAGGACTACTACAAGGTCCTCGGCGTCCCTAAGGACGCGTCC
ATCGACGAAATCAAGAAGGCATACCGGAAACTGGCCCGCCAGTATCATCCGGATGCCAACAAGGGCGACCCGAAGGCCGAGGAGCGGTTC
AAGGAGATTTCGGAAGCCTACGACGTTCTCTCCGACGAGAAGAAGCGCAAGGAGTACGACGAAGCGCGCTCGCTCTTCGGCAGCGGCGGA
TTCCGCATCCCCACCGGCTCCGGCACCGGCACGACCGGAGGTTTCCCGTTCGACCTGGGTGACCTCTTCGGTGGGCTGCGCACCGGAGGC
TTGGGCGACATTCTCGGCGGAATTTTCGGCGGCGGATCGCGGCGTGCCCAGCCGCGGCGCGGCGCGGACGTCGAGACCGAAATCACCATC
AGCTTCACCGACGCGATTCGTGGTGTCACGGTGCCGATCCGGCTCACCAGCCCGGGACCGTGTCCGAGTTGTCACGGGACCGGAGCCCGT
GCCGGCACCATGCCGCGCGTCTGCCCGAACTGTTCGGGTACCGGCATGGTGTCCCGGGTGGTCGGCGGTTTCGCGCTGTCCGAACCATGC
CGGGAGTGTCGCGGCCGGGGTCTCGTCGTCGATGACCCCTGCCCGAGCTGCCGGGGCAGCGGCCGGGCGACGAGCGAGCGCACGCTGCAG
GTGCGCATTCCCGCCGGTGTTGACGACGGCCAGCGCATCCGGCTCAAGGGGCGCGGCGCTCCCGGTGAGAACGGTGGACCGGCGGGCGAC
CTTATCGTCCTCGTGCATGTCCAACCGCACAAGGTCTTTGGCCGGTCCGGGCCGAACCTCACCCTCACGCTGCCGGTGACGTTCCCCGAG
GCGGCGCTCGGCGCGACGATCGAGGTTCCGACGCTCGATGGGCCGGTGACCGTGAAGTTGCCGCCTGGGACGTCCAGCGGCCGTGTCCTG
CGGGTGCGCGGCAAAGGCGCGCCACGCCGGGACGGCAGCCGCGGGGATCTGCTCGTCACCGTGGAGGTCGTCGTACCGAAGAAGCTGTCG
AGCAAAGCCCGCGAGGCACTGGAAGCGTTCCGGAGTGCGACCGAGGACGAGAATCCCCGGGCCGGATTGCTGGTCGGCAGCTGA

Gene Information
Molecule Type genomic DNA
Bases 1164 Bases
Molecular Weight360254.21 Da
Coding Sequence CP000481.1:2396442..2397605
NCBI ReferenceABK53889
NotesTIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 18 to 80 63 N-terminal DnaJ domain PF00226
G/F-rich region 86 to 132 47 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 158 to 238 81 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 251 to 371 121 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCE1

Accession Number

HSP40_0023

Added on

2012-02-02

Updated On

2014-01-20