Help  Custom Search
 
Fe-S protein assembly co-chaperone HscB of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Fe-S protein assembly co-chaperone HscB

Synonymous Names

C1F1Z9_ACIC5, Hsp40/J-protein

Gene names

Gene Name

hscB

Gene Locus Tag

ACP_2547

Gene Identifier

7698777

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MQNATTSVSGVCWSCGQTLEGSAALCAACGKVQPVISEGGEQPDYFRVFGLPRKLALDTAALERSFYRLS RKLHPDVYARASAEEQQWSLDQTSLLNDAYRTLKNPVARTEYLLKLEGKPIASEEQQAQSGVQPGATKEA RVPADMLEEVFELNMQLEEMRMNRKMGEDDPALRGDLEKARAQFEAQLAAVDEDLKTLWQQWDAAIDADA SATAEPVKDKMFSLLDRRRYIRNLVRDVNDALGA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCAAAATGCCACCACCTCCGTCTCTGGTGTCTGCTGGTCCTGCGGTCAAACGCTTGAGGGCTCTGCGGCCTTGTGCGCGGCCTGCGG
AAAAGTGCAGCCGGTCATTTCTGAAGGCGGAGAGCAGCCGGACTACTTCCGCGTCTTCGGCCTGCCGCGCAAGCTTGCACTCGACACCGC
CGCTCTCGAGCGCAGCTTCTACCGCCTCAGCCGCAAGCTGCATCCCGACGTTTACGCACGCGCCTCGGCCGAGGAGCAGCAATGGAGCCT
CGACCAGACCTCGCTGCTCAACGACGCCTACCGCACGCTCAAGAATCCTGTAGCGCGCACCGAGTATCTGCTCAAGCTCGAAGGCAAACC
CATCGCCAGCGAAGAGCAGCAGGCCCAAAGCGGAGTCCAGCCCGGTGCTACCAAAGAAGCTCGCGTGCCCGCAGACATGCTCGAAGAGGT
CTTCGAGCTGAACATGCAGCTTGAAGAGATGCGCATGAACCGCAAAATGGGCGAGGATGATCCCGCTCTCCGCGGCGATCTTGAGAAAGC
ACGCGCGCAGTTTGAAGCGCAGCTCGCCGCCGTTGACGAAGACCTGAAGACCCTGTGGCAGCAATGGGACGCGGCCATCGACGCAGATGC
GTCCGCCACCGCCGAGCCGGTGAAGGACAAGATGTTCTCCCTGCTCGACCGCCGCCGCTATATTCGTAACCTTGTTCGTGACGTAAACGA
CGCACTCGGCGCTTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine15622 %
Guanine21229 %
Thyamine12317 %
Cytosine24434 %
A+T27938 %
G+C45663 %

Total Bases :   735 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC32123
CGCGCG54023
CCGCCGCCG67733

Microsatellite Map

ATGCAAAATGCCACCACCTCCGTCTCTGGTGTCTGCTGGTCCTGCGGTCAAACGCTTGAGGGCTCTGCGGCCTTGTGCGCGGCCTGCGGA
AAAGTGCAGCCGGTCATTTCTGAAGGCGGAGAGCAGCCGGACTACTTCCGCGTCTTCGGCCTGCCGCGCAAGCTTGCACTCGACACCGCC
GCTCTCGAGCGCAGCTTCTACCGCCTCAGCCGCAAGCTGCATCCCGACGTTTACGCACGCGCCTCGGCCGAGGAGCAGCAATGGAGCCTC
GACCAGACCTCGCTGCTCAACGACGCCTACCGCACGCTCAAGAATCCTGTAGCGCGCACCGAGTATCTGCTCAAGCTCGAAGGCAAACCC
ATCGCCAGCGAAGAGCAGCAGGCCCAAAGCGGAGTCCAGCCCGGTGCTACCAAAGAAGCTCGCGTGCCCGCAGACATGCTCGAAGAGGTC
TTCGAGCTGAACATGCAGCTTGAAGAGATGCGCATGAACCGCAAAATGGGCGAGGATGATCCCGCTCTCCGCGGCGATCTTGAGAAAGCA
CGCGCGCAGTTTGAAGCGCAGCTCGCCGCCGTTGACGAAGACCTGAAGACCCTGTGGCAGCAATGGGACGCGGCCATCGACGCAGATGCG
TCCGCCACCGCCGAGCCGGTGAAGGACAAGATGTTCTCCCTGCTCGACCGCCGCCGCTATATTCGTAACCTTGTTCGTGACGTAAACGAC
GCACTCGGCGCTTAG

Gene Information
Molecule Type genomic DNA
Bases 735 Bases
Molecular Weight226567.84 Da
Coding Sequence CP001472.1:2952837..2953571
NCBI ReferenceACO34567
Notesidentified by similarity to SP:P36540; match to

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 44 to 113 70 N-terminal DnaJ domain PF00226

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCA3

Accession Number

HSP40_0022

Added on

2012-02-02

Updated On

2014-01-20