Help  Custom Search
 
Chaperone protein, DnaJ family of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein, DnaJ family

Synonymous Names

C1F2Q2_ACIC5, Hsp40/J-protein

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MANPQQKDYYGTLGIKKTATADEIRKAFRKLARKYHPDVNPGDKKAEEKFKEISEANDILGDEKKRKIYD QFGFYSDQIDPAAAEAAARQGYAPGAGSPRGGGQQGVPFDFGGFDFSDYQGGGAQQGGGFGGSFRDIFSG IFNQGGGRQPRGPQPGTDLEYQIEVDFWTAIRGGTARLQIQRQEVCPTCHGKASTGGPHACPECHGSGQV TQMGGRMKFNIQCPRCGGSGKVQNACPTCHGDGTVTRSEPLEFRIKAGTRDGQRIRLAGRGNAGTHGGQP GDLYLIIRMGTHPVFQRLGDDIHLTVPVTIAEAALGAKIEVPTIDGRAQLKIPPGTQSGQKLRMRERGVP SATREGQRGDEIVTVEIVVPQLRDERSKEILREFSKLNPEDPREAVFAKV

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCCAATCCGCAGCAAAAAGACTATTACGGCACCCTCGGCATCAAAAAGACGGCCACGGCGGACGAGATCCGCAAGGCCTTTCGCAA
ACTCGCGCGCAAATATCACCCCGATGTGAACCCAGGCGACAAAAAGGCCGAAGAGAAGTTCAAGGAAATCTCAGAGGCCAACGACATTCT
GGGCGACGAAAAGAAGCGCAAAATCTACGACCAGTTCGGCTTCTACTCCGACCAGATTGACCCGGCGGCGGCTGAGGCGGCGGCGCGGCA
GGGCTATGCGCCGGGCGCTGGCAGCCCGCGCGGCGGCGGCCAGCAGGGCGTTCCCTTTGACTTCGGCGGCTTTGACTTCAGCGACTATCA
GGGCGGCGGCGCGCAGCAGGGTGGCGGCTTTGGCGGCAGCTTCCGCGATATTTTCTCCGGCATTTTTAACCAGGGCGGCGGCCGCCAGCC
GCGCGGCCCCCAGCCAGGCACCGATCTGGAGTACCAGATCGAGGTCGATTTCTGGACCGCCATTCGCGGCGGTACGGCGCGGCTGCAGAT
TCAGCGGCAGGAGGTCTGCCCGACCTGCCACGGCAAGGCCTCCACGGGCGGCCCGCACGCCTGCCCCGAGTGCCACGGCTCCGGCCAGGT
CACGCAGATGGGCGGCCGCATGAAGTTCAACATTCAATGTCCGCGCTGCGGCGGCTCGGGCAAGGTGCAGAACGCCTGCCCCACCTGCCA
CGGCGACGGCACGGTCACGCGCTCTGAGCCGCTGGAATTTCGCATCAAGGCAGGCACGCGCGACGGCCAGCGCATCCGGCTGGCGGGGCG
CGGCAACGCCGGCACGCACGGCGGCCAGCCCGGCGACCTTTACCTGATCATCCGCATGGGCACGCACCCGGTCTTTCAGCGGCTGGGCGA
TGACATTCACCTGACCGTGCCGGTCACCATTGCCGAGGCCGCGCTCGGGGCCAAGATTGAGGTGCCCACCATCGATGGCCGCGCACAGTT
GAAGATTCCGCCCGGCACGCAGAGCGGCCAGAAGCTGCGCATGCGCGAGCGCGGCGTGCCCTCAGCCACGCGCGAGGGCCAGCGCGGCGA
TGAAATTGTCACGGTGGAGATCGTGGTGCCGCAGCTTCGCGACGAGCGGTCCAAAGAGATTCTGCGCGAATTCTCAAAGCTCAACCCGGA
AGACCCGCGCGAAGCCGTCTTTGCGAAGGTTTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine23520 %
Guanine39633 %
Thyamine17315 %
Cytosine39934 %
A+T40834 %
G+C79567 %

Total Bases :   1203 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG9223
CGGCGGCGG24133
GGCGGCGGC25433
CGCGCG29523
GGCGGCGGC36033
GGCGGCGGC43233
CGCGCG44823
CGCGCG77523
CGCGCG105723
CGCGCG117423

Microsatellite Map

ATGGCCAATCCGCAGCAAAAAGACTATTACGGCACCCTCGGCATCAAAAAGACGGCCACGGCGGACGAGATCCGCAAGGCCTTTCGCAAA
CTCGCGCGCAAATATCACCCCGATGTGAACCCAGGCGACAAAAAGGCCGAAGAGAAGTTCAAGGAAATCTCAGAGGCCAACGACATTCTG
GGCGACGAAAAGAAGCGCAAAATCTACGACCAGTTCGGCTTCTACTCCGACCAGATTGACCCGGCGGCGGCTGAGGCGGCGGCGCGGCAG
GGCTATGCGCCGGGCGCTGGCAGCCCGCGCGGCGGCGGCCAGCAGGGCGTTCCCTTTGACTTCGGCGGCTTTGACTTCAGCGACTATCAG
GGCGGCGGCGCGCAGCAGGGTGGCGGCTTTGGCGGCAGCTTCCGCGATATTTTCTCCGGCATTTTTAACCAGGGCGGCGGCCGCCAGCCG
CGCGGCCCCCAGCCAGGCACCGATCTGGAGTACCAGATCGAGGTCGATTTCTGGACCGCCATTCGCGGCGGTACGGCGCGGCTGCAGATT
CAGCGGCAGGAGGTCTGCCCGACCTGCCACGGCAAGGCCTCCACGGGCGGCCCGCACGCCTGCCCCGAGTGCCACGGCTCCGGCCAGGTC
ACGCAGATGGGCGGCCGCATGAAGTTCAACATTCAATGTCCGCGCTGCGGCGGCTCGGGCAAGGTGCAGAACGCCTGCCCCACCTGCCAC
GGCGACGGCACGGTCACGCGCTCTGAGCCGCTGGAATTTCGCATCAAGGCAGGCACGCGCGACGGCCAGCGCATCCGGCTGGCGGGGCGC
GGCAACGCCGGCACGCACGGCGGCCAGCCCGGCGACCTTTACCTGATCATCCGCATGGGCACGCACCCGGTCTTTCAGCGGCTGGGCGAT
GACATTCACCTGACCGTGCCGGTCACCATTGCCGAGGCCGCGCTCGGGGCCAAGATTGAGGTGCCCACCATCGATGGCCGCGCACAGTTG
AAGATTCCGCCCGGCACGCAGAGCGGCCAGAAGCTGCGCATGCGCGAGCGCGGCGTGCCCTCAGCCACGCGCGAGGGCCAGCGCGGCGAT
GAAATTGTCACGGTGGAGATCGTGGTGCCGCAGCTTCGCGACGAGCGGTCCAAAGAGATTCTGCGCGAATTCTCAAAGCTCAACCCGGAA
GACCCGCGCGAAGCCGTCTTTGCGAAGGTTTAG

Gene Information
Molecule Type genomic DNA
Bases 1203 Bases
Molecular Weight371918.97 Da
Coding Sequence CP001472.1:920995..922197
NCBI ReferenceACO32015
Notesidentified by match to protein family HMM PF00226;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 8 to 70 63 N-terminal DnaJ domain PF00226
G/F-rich region 101 to 147 47 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 173 to 250 78 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 263 to 385 123 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCA2

Accession Number

HSP40_0021

Added on

2012-02-02

Updated On

2014-01-20