Help  Custom Search
 
Chaperone protein DnaJ of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein DnaJ

Synonymous Names

C1F925_ACIC5, Hsp40/J-protein, DnaJ

Gene names

Gene Name

dnaJ

Gene Locus Tag

ACP_2088

Gene Identifier

7697946

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MSRTANVTKLDYYEVLGVERTANDQELKTAYRKLALQYHPDRNPGNPEAEEQFKACSEAYQVLSDPQKRA AYDRFGHAGVNGGGPAAGGFDGSPFGGFEDLGDIFGDLFGFNVGGRGSRGGNSRVQKGRDVRCDLTLAFE EAVFGKETHVTIHRREACGDCNGTGAAAGRGPVTCGQCQGRGQVRYQQGFFSIARTCSACGGSGQVISDP CPTCRGDGRVDKQRNIAVHVPAGVEDGTRIRYQGEGDVGRFGGPAGDLYVVLSVQPHKFFERDGNDLHCA IPISFPQASLGTELTLPSLDGEVRLKIPEGTQSGKEFRVRGKGVPHLNEHGRGDLIVQIVVQTPTKLSKV QKELMRQLSDSLTVENTPTSRSSLFEKVKEIFS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGCAGAACGGCAAACGTGACCAAACTCGACTATTACGAAGTCCTCGGCGTAGAACGGACCGCGAACGATCAGGAGCTGAAGACGGC
TTATCGCAAGCTGGCGCTGCAGTATCATCCTGACCGAAACCCGGGCAATCCTGAGGCGGAAGAGCAATTCAAGGCCTGCAGCGAGGCTTA
CCAGGTGCTCAGCGATCCCCAAAAGCGAGCGGCCTATGACCGCTTTGGCCATGCCGGGGTGAATGGCGGCGGCCCGGCGGCGGGCGGCTT
TGACGGCTCGCCTTTTGGCGGCTTTGAGGACCTGGGCGACATTTTTGGCGACCTGTTTGGCTTCAATGTCGGCGGGCGCGGCAGCCGGGG
CGGCAACTCGCGCGTGCAAAAGGGCCGCGATGTGCGCTGCGACCTCACGCTGGCCTTTGAAGAGGCGGTGTTCGGCAAGGAGACGCACGT
CACCATTCATCGCCGCGAGGCGTGCGGAGACTGCAACGGCACGGGCGCGGCGGCCGGGCGCGGACCCGTCACCTGCGGCCAGTGCCAGGG
ACGCGGCCAGGTGCGCTATCAGCAGGGCTTCTTCTCGATTGCGCGCACGTGCAGCGCCTGCGGCGGTTCCGGACAGGTGATCAGCGACCC
GTGCCCTACCTGCCGGGGCGATGGGCGCGTGGACAAGCAGCGCAACATCGCTGTGCATGTGCCGGCGGGCGTGGAAGACGGCACGCGCAT
TCGCTACCAGGGTGAAGGCGATGTGGGCCGCTTTGGCGGTCCGGCGGGCGACCTGTACGTGGTGCTGTCAGTGCAGCCGCACAAGTTTTT
TGAGCGCGACGGCAATGACCTGCACTGTGCGATTCCCATCTCGTTTCCTCAAGCCTCGCTGGGCACCGAGCTGACGCTGCCCTCGCTCGA
CGGCGAGGTACGGCTGAAGATTCCCGAGGGCACGCAAAGCGGCAAGGAGTTTCGCGTGCGCGGCAAGGGCGTGCCGCACCTCAACGAGCA
TGGACGGGGCGACCTGATTGTGCAGATTGTTGTGCAGACGCCGACCAAGCTCAGCAAGGTGCAGAAGGAACTGATGCGCCAGTTGAGCGA
CTCGCTCACGGTGGAGAACACGCCGACCTCGCGCAGCAGCCTGTTTGAGAAGGTGAAAGAGATCTTCTCGTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine21719 %
Guanine40436 %
Thyamine19317 %
Cytosine33830 %
A+T41036 %
G+C74265 %

Total Bases :   1152 bases

Microsatellites
SequencePosition LengthRepeats
GGCGGCGGC24333
CGGCGGCGG25333
CGCGCG36723
GCGCGC57923
TTTTTT80423

Microsatellite Map

ATGAGCAGAACGGCAAACGTGACCAAACTCGACTATTACGAAGTCCTCGGCGTAGAACGGACCGCGAACGATCAGGAGCTGAAGACGGCT
TATCGCAAGCTGGCGCTGCAGTATCATCCTGACCGAAACCCGGGCAATCCTGAGGCGGAAGAGCAATTCAAGGCCTGCAGCGAGGCTTAC
CAGGTGCTCAGCGATCCCCAAAAGCGAGCGGCCTATGACCGCTTTGGCCATGCCGGGGTGAATGGCGGCGGCCCGGCGGCGGGCGGCTTT
GACGGCTCGCCTTTTGGCGGCTTTGAGGACCTGGGCGACATTTTTGGCGACCTGTTTGGCTTCAATGTCGGCGGGCGCGGCAGCCGGGGC
GGCAACTCGCGCGTGCAAAAGGGCCGCGATGTGCGCTGCGACCTCACGCTGGCCTTTGAAGAGGCGGTGTTCGGCAAGGAGACGCACGTC
ACCATTCATCGCCGCGAGGCGTGCGGAGACTGCAACGGCACGGGCGCGGCGGCCGGGCGCGGACCCGTCACCTGCGGCCAGTGCCAGGGA
CGCGGCCAGGTGCGCTATCAGCAGGGCTTCTTCTCGATTGCGCGCACGTGCAGCGCCTGCGGCGGTTCCGGACAGGTGATCAGCGACCCG
TGCCCTACCTGCCGGGGCGATGGGCGCGTGGACAAGCAGCGCAACATCGCTGTGCATGTGCCGGCGGGCGTGGAAGACGGCACGCGCATT
CGCTACCAGGGTGAAGGCGATGTGGGCCGCTTTGGCGGTCCGGCGGGCGACCTGTACGTGGTGCTGTCAGTGCAGCCGCACAAGTTTTTT
GAGCGCGACGGCAATGACCTGCACTGTGCGATTCCCATCTCGTTTCCTCAAGCCTCGCTGGGCACCGAGCTGACGCTGCCCTCGCTCGAC
GGCGAGGTACGGCTGAAGATTCCCGAGGGCACGCAAAGCGGCAAGGAGTTTCGCGTGCGCGGCAAGGGCGTGCCGCACCTCAACGAGCAT
GGACGGGGCGACCTGATTGTGCAGATTGTTGTGCAGACGCCGACCAAGCTCAGCAAGGTGCAGAAGGAACTGATGCGCCAGTTGAGCGAC
TCGCTCACGGTGGAGAACACGCCGACCTCGCGCAGCAGCCTGTTTGAGAAGGTGAAAGAGATCTTCTCGTAG

Gene Information
Molecule Type genomic DNA
Bases 1152 Bases
Molecular Weight357358.89 Da
Coding Sequence CP001472.1:2447909..2449060
NCBI ReferenceACO33779
Notesidentified by similarity to SP:P08622; match to

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 11 to 73 63 N-terminal DnaJ domain PF00226
G/F-rich region 82 to 115 34 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 145 to 225 81 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 238 to 359 122 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCA1

Accession Number

HSP40_0020

Added on

2012-02-02

Updated On

2014-01-20