Help  Custom Search
 
chaperone DnaJ domain-containing protein of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone DnaJ domain-containing protein

Synonymous Names

B5EQJ6_ACIF5, Hsp40/J-protein

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type II J-Protein

SEQUENCE INFORMATION

Sequence
MEYKDYYKILGVERSADADAIKASYRKMARKYHPDVSKERDAEERFKDLQEAYEVLKDPEKRAAYDQLGS NWRAGQEFRPPPGWGQAAGGGFGGGGGGFSDFFESIFRQQGGGFGSGGASGFRSQGEDSEATIRVSLEDA AHGAQREISLEVPTMGPDGRMRREARRLTVKIPKGIREGQRLRMAGQGAPGMGGGPNGDLYLHIQFLPHP RFRIEGSDLYHDLHITPWEAVLGASVEVPTLDGDVRMKIPAGSTSGQKLRLSQKGLPGAGSKPPGDLYAV IQIVVPKKISEPEKALWNQLAEMSDFHPRR

FASTA Format Composition Secondary Structure

Nucleotide
 TTGGAATACAAGGACTACTACAAAATTCTGGGAGTCGAACGCAGCGCCGATGCCGATGCCATCAAAGCGTCTTATCGCAAAATGGCGCG
CAAATATCACCCGGATGTGAGTAAGGAAAGGGATGCGGAGGAACGCTTCAAGGACCTCCAGGAAGCCTACGAGGTGCTCAAGGACCCGGA
GAAACGCGCCGCCTATGACCAGTTGGGCAGCAACTGGCGCGCCGGCCAGGAGTTCCGGCCCCCGCCCGGTTGGGGTCAGGCGGCCGGGGG
TGGCTTTGGCGGGGGTGGCGGCGGGTTCAGCGACTTTTTCGAGTCCATATTCCGCCAGCAGGGTGGTGGCTTCGGAAGCGGCGGGGCGAG
CGGATTCCGCAGCCAGGGCGAAGATAGCGAGGCGACGATCCGCGTCAGCCTAGAGGATGCGGCCCACGGCGCCCAACGTGAGATCAGCCT
GGAAGTACCCACCATGGGTCCCGATGGCCGTATGCGCCGTGAAGCGCGGCGCCTGACCGTCAAGATCCCCAAAGGCATCCGCGAAGGGCA
GCGACTGCGTATGGCGGGGCAGGGTGCGCCGGGTATGGGTGGCGGTCCCAATGGGGATCTGTACCTGCACATCCAGTTTCTGCCACACCC
CAGATTTCGGATAGAGGGCAGTGATTTATATCATGACCTGCACATCACTCCGTGGGAGGCGGTGCTCGGCGCCAGCGTCGAAGTTCCCAC
CCTGGATGGCGACGTGCGCATGAAGATTCCGGCCGGTAGCACCAGCGGGCAGAAGCTGCGACTCAGTCAAAAGGGATTGCCGGGCGCCGG
CAGTAAACCACCTGGAGATTTGTATGCCGTAATCCAGATTGTCGTCCCCAAAAAAATCAGCGAACCGGAAAAAGCCCTGTGGAACCAACT
GGCAGAGATGTCCGACTTCCATCCCCGCCGCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine20522 %
Guanine31034 %
Thyamine15317 %
Cytosine26529 %
A+T35839 %
G+C57562 %

Total Bases :   933 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC8423
GCGCGC21523
AAAAAA85823

Microsatellite Map

TTGGAATACAAGGACTACTACAAAATTCTGGGAGTCGAACGCAGCGCCGATGCCGATGCCATCAAAGCGTCTTATCGCAAAATGGCGCGC
AAATATCACCCGGATGTGAGTAAGGAAAGGGATGCGGAGGAACGCTTCAAGGACCTCCAGGAAGCCTACGAGGTGCTCAAGGACCCGGAG
AAACGCGCCGCCTATGACCAGTTGGGCAGCAACTGGCGCGCCGGCCAGGAGTTCCGGCCCCCGCCCGGTTGGGGTCAGGCGGCCGGGGGT
GGCTTTGGCGGGGGTGGCGGCGGGTTCAGCGACTTTTTCGAGTCCATATTCCGCCAGCAGGGTGGTGGCTTCGGAAGCGGCGGGGCGAGC
GGATTCCGCAGCCAGGGCGAAGATAGCGAGGCGACGATCCGCGTCAGCCTAGAGGATGCGGCCCACGGCGCCCAACGTGAGATCAGCCTG
GAAGTACCCACCATGGGTCCCGATGGCCGTATGCGCCGTGAAGCGCGGCGCCTGACCGTCAAGATCCCCAAAGGCATCCGCGAAGGGCAG
CGACTGCGTATGGCGGGGCAGGGTGCGCCGGGTATGGGTGGCGGTCCCAATGGGGATCTGTACCTGCACATCCAGTTTCTGCCACACCCC
AGATTTCGGATAGAGGGCAGTGATTTATATCATGACCTGCACATCACTCCGTGGGAGGCGGTGCTCGGCGCCAGCGTCGAAGTTCCCACC
CTGGATGGCGACGTGCGCATGAAGATTCCGGCCGGTAGCACCAGCGGGCAGAAGCTGCGACTCAGTCAAAAGGGATTGCCGGGCGCCGGC
AGTAAACCACCTGGAGATTTGTATGCCGTAATCCAGATTGTCGTCCCCAAAAAAATCAGCGAACCGGAAAAAGCCCTGTGGAACCAACTG
GCAGAGATGTCCGACTTCCATCCCCGCCGCTGA

Gene Information
Molecule Type genomic DNA
Bases 933 Bases
Molecular Weight289376.49 Da
Coding Sequence CP001132.1:2687745..2688677
NCBI ReferenceACH84893
NotesPFAM: heat shock protein DnaJ domain protein;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 5 to 66 62 N-terminal DnaJ domain PF00226
G/F-rich region 89 to 122 34 Glycine-phenylalanine rich region Manually identified
C-terminal domain 180 to 301 122 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACFE2

Accession Number

HSP40_0019

Added on

2012-02-02

Updated On

2014-01-20