Help  Custom Search
 
Chaperone protein DnaJ of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein DnaJ

Synonymous Names

DNAJ_ACIF5, Hsp40/J-protein, DnaJ

Gene names

Gene Name

dnaJ

Gene Locus Tag

Lferr_2290

Gene Identifier

6878284

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MATRDYYEVLEISRTADDGEIKKSYRRLAMRYHPDRNPDDASAEERFKEISAAYEVLSDPQKRQAYDRFG HAGVNGGGGGPGAGFGGGGGGFGDVFSDLFEQAFGGGFRGQDSGRGADLRYELELTLEEAALGKEVTIQI PSSATCEVCRGSGAKPGSAVEDCATCGGRGQVRMVQGFFSVTRPCPQCNGSGKVIKEPCTNCHGHGRVRR NRDLQVKVPAGVDTGDRIRLNGEGEAGERGGPAGDLYIQVRVLPHALFERDGDDLHCAVPVQFTTMAMGG ELEVPTLTGRAKVQIAPGTQSGAVFRLRGKGIKGVRSKLNGDLHCQLQVEVPVHLSARQKELLEEFAREG GDNIQHPQQESWWNKAKDFFDRMGL

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCCACACGGGATTACTACGAAGTACTGGAAATTTCCCGCACGGCAGACGACGGCGAGATCAAGAAGTCTTACCGGCGTCTGGCGAT
GCGTTATCACCCGGATCGCAATCCGGATGATGCGAGCGCAGAAGAGCGCTTCAAAGAAATCAGCGCAGCCTACGAGGTGCTCTCCGACCC
GCAGAAACGGCAGGCCTATGATCGATTTGGCCATGCCGGAGTGAATGGCGGCGGCGGTGGGCCGGGTGCCGGCTTTGGTGGAGGCGGTGG
GGGGTTCGGCGACGTTTTCAGCGATCTCTTCGAACAGGCTTTCGGCGGCGGTTTTCGCGGCCAGGATTCGGGGCGTGGCGCCGATCTGCG
TTACGAACTGGAGCTTACGCTGGAAGAGGCGGCTCTGGGTAAAGAAGTCACCATTCAGATTCCCAGTTCGGCGACTTGCGAGGTGTGTCG
CGGCAGTGGCGCCAAACCGGGCAGCGCGGTGGAGGATTGCGCCACCTGTGGCGGCCGTGGTCAGGTCCGGATGGTACAGGGCTTCTTTTC
CGTTACCCGTCCCTGCCCGCAGTGCAACGGTAGCGGCAAGGTCATCAAGGAGCCCTGCACGAACTGCCATGGTCATGGTCGGGTTCGCAG
GAACCGCGATCTGCAGGTCAAAGTCCCCGCTGGAGTGGATACGGGGGATCGTATCCGTCTGAATGGTGAGGGCGAAGCGGGCGAGCGGGG
TGGTCCGGCGGGAGACCTGTATATTCAGGTGCGGGTGTTGCCCCATGCGCTCTTTGAGCGGGACGGCGACGATCTGCACTGTGCGGTGCC
GGTACAGTTTACGACCATGGCCATGGGCGGTGAACTGGAAGTGCCGACCCTGACCGGGCGTGCCAAGGTGCAGATTGCTCCGGGTACCCA
GTCGGGCGCAGTATTCCGTCTGCGCGGCAAGGGCATCAAGGGGGTGCGCAGCAAGCTCAATGGCGATCTGCATTGCCAGCTCCAGGTGGA
GGTGCCGGTACATCTCTCTGCCCGGCAAAAGGAGTTGCTGGAGGAGTTCGCCCGGGAAGGCGGCGATAATATCCAGCATCCCCAGCAGGA
AAGCTGGTGGAACAAGGCCAAAGACTTTTTCGACCGGATGGGCCTCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine21520 %
Guanine40236 %
Thyamine21419 %
Cytosine29727 %
A+T42939 %
G+C69962 %

Total Bases :   1128 bases

Microsatellites
SequencePosition LengthRepeats
GGCGGCGGC22533
GGGGGG26723
CGGCGGCGG31133
GTGTGT44123
TCTCTC100123

Microsatellite Map

ATGGCCACACGGGATTACTACGAAGTACTGGAAATTTCCCGCACGGCAGACGACGGCGAGATCAAGAAGTCTTACCGGCGTCTGGCGATG
CGTTATCACCCGGATCGCAATCCGGATGATGCGAGCGCAGAAGAGCGCTTCAAAGAAATCAGCGCAGCCTACGAGGTGCTCTCCGACCCG
CAGAAACGGCAGGCCTATGATCGATTTGGCCATGCCGGAGTGAATGGCGGCGGCGGTGGGCCGGGTGCCGGCTTTGGTGGAGGCGGTGGG
GGGTTCGGCGACGTTTTCAGCGATCTCTTCGAACAGGCTTTCGGCGGCGGTTTTCGCGGCCAGGATTCGGGGCGTGGCGCCGATCTGCGT
TACGAACTGGAGCTTACGCTGGAAGAGGCGGCTCTGGGTAAAGAAGTCACCATTCAGATTCCCAGTTCGGCGACTTGCGAGGTGTGTCGC
GGCAGTGGCGCCAAACCGGGCAGCGCGGTGGAGGATTGCGCCACCTGTGGCGGCCGTGGTCAGGTCCGGATGGTACAGGGCTTCTTTTCC
GTTACCCGTCCCTGCCCGCAGTGCAACGGTAGCGGCAAGGTCATCAAGGAGCCCTGCACGAACTGCCATGGTCATGGTCGGGTTCGCAGG
AACCGCGATCTGCAGGTCAAAGTCCCCGCTGGAGTGGATACGGGGGATCGTATCCGTCTGAATGGTGAGGGCGAAGCGGGCGAGCGGGGT
GGTCCGGCGGGAGACCTGTATATTCAGGTGCGGGTGTTGCCCCATGCGCTCTTTGAGCGGGACGGCGACGATCTGCACTGTGCGGTGCCG
GTACAGTTTACGACCATGGCCATGGGCGGTGAACTGGAAGTGCCGACCCTGACCGGGCGTGCCAAGGTGCAGATTGCTCCGGGTACCCAG
TCGGGCGCAGTATTCCGTCTGCGCGGCAAGGGCATCAAGGGGGTGCGCAGCAAGCTCAATGGCGATCTGCATTGCCAGCTCCAGGTGGAG
GTGCCGGTACATCTCTCTGCCCGGCAAAAGGAGTTGCTGGAGGAGTTCGCCCGGGAAGGCGGCGATAATATCCAGCATCCCCAGCAGGAA
AGCTGGTGGAACAAGGCCAAAGACTTTTTCGACCGGATGGGCCTCTGA

Gene Information
Molecule Type genomic DNA
Bases 1128 Bases
Molecular Weight350605.87 Da
Coding Sequence complement(CP001132.1:2260618..2261745)
NCBI ReferenceACH84491
NotesTIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 5 to 67 63 N-terminal DnaJ domain PF00226
G/F-rich region 76 to 110 35 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 133 to 213 81 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 226 to 347 122 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACFE1

Accession Number

HSP40_0018

Added on

2012-02-02

Updated On

2014-01-20