Help  Custom Search
 
heat shock protein DnaJ domain-containing protein of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein DnaJ domain-containing protein

Synonymous Names

A5FZ85_ACICJ, Hsp40/J-protein

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MRAFAPDPDAPGRACDMPDCDKQGEYRAPRSREHLRDWHWFCLEHVRAYNAGWDYYKGMSPGEIEAHLRA DTAWQRPTWPLGRAGAVGEAVEAELAAFSGLGRARRPEPERAPPELREALDVLGLAWPVTREAVRARYKE LAKRHHPDANGGDRSAEERLKTINLAYATLRARLPAAEGQPRAAAGA

FASTA Format Composition Secondary Structure

Nucleotide
 GTGCGCGCCTTCGCGCCCGACCCGGATGCCCCGGGCCGCGCCTGCGACATGCCCGACTGCGACAAGCAAGGCGAATACCGCGCCCCCCG
CTCGCGCGAGCACCTGCGCGACTGGCACTGGTTCTGCCTCGAGCATGTCCGCGCCTACAATGCCGGCTGGGACTACTACAAGGGCATGAG
CCCCGGCGAGATCGAGGCGCATCTGCGCGCCGACACCGCCTGGCAGCGCCCCACCTGGCCGCTCGGTCGCGCCGGCGCCGTCGGCGAGGC
GGTCGAGGCCGAGCTCGCCGCCTTTTCCGGCCTCGGCCGCGCCCGCCGTCCCGAGCCCGAGCGCGCCCCGCCCGAGCTGCGCGAGGCGCT
GGACGTGCTCGGCCTCGCCTGGCCGGTCACCCGCGAGGCGGTGCGCGCCCGCTACAAGGAGCTGGCCAAGCGCCACCACCCGGACGCCAA
TGGCGGCGACCGCAGCGCCGAGGAACGGCTGAAGACGATCAACCTCGCCTACGCGACGCTGCGCGCCCGCCTGCCGGCCGCCGAGGGTCA
GCCCCGCGCCGCCGCCGGCGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine7414 %
Guanine19335 %
Thyamine5911 %
Cytosine23843 %
A+T13324 %
G+C43177 %

Total Bases :   564 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC223
CCCCCC8223
CGCGCG9123
GCGCGC20323
GCGCGC32923
GCGCGC40123
GCGCGC50923
CGCCGCCGC54533

Microsatellite Map

GTGCGCGCCTTCGCGCCCGACCCGGATGCCCCGGGCCGCGCCTGCGACATGCCCGACTGCGACAAGCAAGGCGAATACCGCGCCCCCCGC
TCGCGCGAGCACCTGCGCGACTGGCACTGGTTCTGCCTCGAGCATGTCCGCGCCTACAATGCCGGCTGGGACTACTACAAGGGCATGAGC
CCCGGCGAGATCGAGGCGCATCTGCGCGCCGACACCGCCTGGCAGCGCCCCACCTGGCCGCTCGGTCGCGCCGGCGCCGTCGGCGAGGCG
GTCGAGGCCGAGCTCGCCGCCTTTTCCGGCCTCGGCCGCGCCCGCCGTCCCGAGCCCGAGCGCGCCCCGCCCGAGCTGCGCGAGGCGCTG
GACGTGCTCGGCCTCGCCTGGCCGGTCACCCGCGAGGCGGTGCGCGCCCGCTACAAGGAGCTGGCCAAGCGCCACCACCCGGACGCCAAT
GGCGGCGACCGCAGCGCCGAGGAACGGCTGAAGACGATCAACCTCGCCTACGCGACGCTGCGCGCCCGCCTGCCGGCCGCCGAGGGTCAG
CCCCGCGCCGCCGCCGGCGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 564 Bases
Molecular Weight173425.75 Da
Coding Sequence complement(CP000697.1:1895516..1896079)
NCBI ReferenceABQ30917
NotesPFAM: heat shock protein DnaJ domain protein

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 118 to 178 61 N-terminal DnaJ domain PF00226

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCR4

Accession Number

HSP40_0017

Added on

2012-02-02

Updated On

2014-01-20