Help  Custom Search
 
heat shock protein DnaJ domain-containing protein of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein DnaJ domain-containing protein

Synonymous Names

A5G2J2_ACICJ, Hsp40/J-protein

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MSVWGKIIGGVAGFAVGGPFGAVAGAALGHAADTGDLGSLGARLGRALPLDSARFAALLGRREQVFAIGA TVLAAKLAKCDGPVVRAEIDAFKRQFRIEDAAIPTIGHLFDQAREDASGFEPYARQLGESFADNRLALEQ VLGALFAIARADGPVNAREADMLARIGALFGLGEAARARAANPSGGNLGEDPYQVLGIARTSSTEAIRAH WKALMRENHPDQLAARGVPAEFIARATERVARINAAWDAIKRERGA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGCGTGTGGGGGAAGATCATCGGCGGCGTCGCGGGGTTCGCCGTCGGCGGGCCGTTCGGCGCCGTGGCCGGCGCAGCGCTGGGCCA
TGCCGCCGATACCGGCGATCTCGGCTCGCTCGGCGCCCGGCTCGGCCGCGCCCTGCCGCTCGACTCCGCCCGCTTTGCCGCCCTGCTCGG
CCGGCGCGAACAGGTGTTCGCCATCGGCGCCACCGTTCTCGCCGCCAAGCTCGCGAAATGCGACGGGCCGGTGGTCCGCGCCGAGATCGA
CGCGTTCAAACGGCAGTTCCGCATCGAGGATGCGGCGATCCCGACGATCGGGCACCTGTTCGACCAGGCGCGCGAGGATGCGTCCGGCTT
CGAGCCCTATGCGCGCCAGCTCGGCGAGAGCTTCGCCGACAACCGCCTTGCCCTCGAGCAAGTGCTCGGCGCTCTGTTCGCCATCGCCCG
GGCGGACGGGCCGGTGAACGCGCGCGAAGCCGACATGCTGGCGCGGATCGGCGCGCTGTTCGGCCTGGGCGAGGCGGCCCGCGCCCGGGC
GGCGAACCCTTCGGGCGGCAATCTCGGTGAGGATCCGTATCAGGTGCTGGGCATCGCCCGCACATCCAGCACCGAGGCGATCCGCGCCCA
CTGGAAGGCCCTGATGCGCGAGAACCATCCGGACCAGCTTGCCGCGCGCGGCGTGCCGGCGGAGTTCATCGCCCGCGCGACCGAACGCGT
CGCCCGGATCAACGCCGCCTGGGACGCCATCAAGCGCGAGCGCGGCGCGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine10114 %
Guanine28037 %
Thyamine10614 %
Cytosine28437 %
A+T20727 %
G+C56474 %

Total Bases :   771 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC33623
GCGCGC36923
CGCGCGCG46724
GCGCGC49923
CGCGCGCG67124
CGCGCG70223

Microsatellite Map

ATGAGCGTGTGGGGGAAGATCATCGGCGGCGTCGCGGGGTTCGCCGTCGGCGGGCCGTTCGGCGCCGTGGCCGGCGCAGCGCTGGGCCAT
GCCGCCGATACCGGCGATCTCGGCTCGCTCGGCGCCCGGCTCGGCCGCGCCCTGCCGCTCGACTCCGCCCGCTTTGCCGCCCTGCTCGGC
CGGCGCGAACAGGTGTTCGCCATCGGCGCCACCGTTCTCGCCGCCAAGCTCGCGAAATGCGACGGGCCGGTGGTCCGCGCCGAGATCGAC
GCGTTCAAACGGCAGTTCCGCATCGAGGATGCGGCGATCCCGACGATCGGGCACCTGTTCGACCAGGCGCGCGAGGATGCGTCCGGCTTC
GAGCCCTATGCGCGCCAGCTCGGCGAGAGCTTCGCCGACAACCGCCTTGCCCTCGAGCAAGTGCTCGGCGCTCTGTTCGCCATCGCCCGG
GCGGACGGGCCGGTGAACGCGCGCGAAGCCGACATGCTGGCGCGGATCGGCGCGCTGTTCGGCCTGGGCGAGGCGGCCCGCGCCCGGGCG
GCGAACCCTTCGGGCGGCAATCTCGGTGAGGATCCGTATCAGGTGCTGGGCATCGCCCGCACATCCAGCACCGAGGCGATCCGCGCCCAC
TGGAAGGCCCTGATGCGCGAGAACCATCCGGACCAGCTTGCCGCGCGCGGCGTGCCGGCGGAGTTCATCGCCCGCGCGACCGAACGCGTC
GCCCGGATCAACGCCGCCTGGGACGCCATCAAGCGCGAGCGCGGCGCGTGA

Gene Information
Molecule Type genomic DNA
Bases 771 Bases
Molecular Weight238123.37 Da
Coding Sequence CP000697.1:3149834..3150604
NCBI ReferenceABQ32074
NotesPFAM: heat shock protein DnaJ domain protein

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
TerB 43 to 182 140 Tellurite resistance protein TerB PF05099
J-domain 191 to 256 66 N-terminal DnaJ domain PF00226
TMhelix 7 to 29 23 Transmembrane helix region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCR3

Accession Number

HSP40_0016

Added on

2012-02-02

Updated On

2014-01-20