Help  Custom Search
 
chaperone DnaJ domain-containing protein of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

chaperone DnaJ domain-containing protein

Synonymous Names

A5G2V0_ACICJ, Hsp40/J-protein

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type II J-Protein

SEQUENCE INFORMATION

Sequence
MKDPYDVLGVARDAGQDDIRRAYRRLAKDHHPDLNPGNAAAEARFKEVSAAYHLLSDADQRARFDRGEID AEGQERARHGTWRDYAETGEGARYGGGAWTTDDLEAMFGSMFGGGGGGRRGGPGRGQDRHYSMTIGFVEA VVGGTRRLSLPDGGTLDVRIPPGTEDGQLLRLRGKGGVGWNGGPAGDALIRVSVAPHRFFTREGQDIRLD LPVTLAEAVLGGQVEVPTPGGAVRMRIPAGSDSGTVLRLRGRGVPAHGAAAAGDLYATLRVVIGKSDPAL ETFLRGWTPEETPDPRAGMTETEVPP

FASTA Format Composition Secondary Structure

Nucleotide
 GTGAAGGATCCTTACGACGTTCTGGGTGTGGCGCGCGATGCGGGGCAGGATGACATAAGGCGGGCCTATCGCCGGCTGGCGAAGGACCA
TCATCCCGACCTCAACCCCGGCAACGCGGCGGCCGAGGCGCGGTTCAAGGAGGTCTCGGCGGCCTATCATCTGCTGTCCGACGCCGATCA
GCGCGCCCGCTTCGACCGCGGCGAGATCGATGCCGAGGGGCAGGAACGCGCGCGGCACGGCACCTGGCGCGACTATGCCGAGACCGGCGA
GGGCGCGCGCTACGGCGGCGGCGCCTGGACCACCGACGATCTCGAGGCGATGTTCGGCTCGATGTTCGGTGGCGGCGGCGGCGGACGGCG
TGGCGGGCCGGGGCGCGGGCAGGACCGGCATTATTCGATGACGATCGGCTTCGTCGAGGCGGTTGTCGGCGGCACGCGGCGGCTGTCGCT
GCCCGATGGCGGCACGCTCGACGTGCGGATTCCCCCCGGCACCGAGGACGGGCAACTGTTGCGCCTGCGCGGCAAGGGCGGGGTGGGATG
GAATGGCGGGCCTGCGGGCGATGCGCTGATCCGCGTCAGCGTGGCGCCGCATCGCTTCTTCACCCGCGAAGGGCAGGATATCCGGCTCGA
TCTGCCGGTGACGCTGGCCGAGGCGGTGCTGGGCGGGCAGGTCGAGGTGCCGACGCCGGGCGGCGCGGTGCGGATGCGGATTCCCGCGGG
CTCGGACAGCGGCACGGTGCTGCGGCTGCGCGGGCGCGGCGTGCCGGCGCATGGCGCCGCCGCCGCGGGCGATCTCTATGCCACGCTGCG
CGTTGTGATTGGCAAGTCTGACCCGGCGCTGGAAACCTTCCTGCGCGGCTGGACGCCGGAGGAGACGCCCGATCCGCGCGCCGGGATGAC
GGAGACGGAGGTGCCGCCATGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine12314 %
Guanine37741 %
Thyamine12915 %
Cytosine29232 %
A+T25228 %
G+C66973 %

Total Bases :   921 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC3023
GCGCGC17923
CGCGCGCG22524
GCGCGCGC27124
CGGCGGCGG28133
GGCGGCGGCGGC33934
CCCCCC48023
CGCCGCCGCCGC77334
CGCGCG88323

Microsatellite Map

GTGAAGGATCCTTACGACGTTCTGGGTGTGGCGCGCGATGCGGGGCAGGATGACATAAGGCGGGCCTATCGCCGGCTGGCGAAGGACCAT
CATCCCGACCTCAACCCCGGCAACGCGGCGGCCGAGGCGCGGTTCAAGGAGGTCTCGGCGGCCTATCATCTGCTGTCCGACGCCGATCAG
CGCGCCCGCTTCGACCGCGGCGAGATCGATGCCGAGGGGCAGGAACGCGCGCGGCACGGCACCTGGCGCGACTATGCCGAGACCGGCGAG
GGCGCGCGCTACGGCGGCGGCGCCTGGACCACCGACGATCTCGAGGCGATGTTCGGCTCGATGTTCGGTGGCGGCGGCGGCGGACGGCGT
GGCGGGCCGGGGCGCGGGCAGGACCGGCATTATTCGATGACGATCGGCTTCGTCGAGGCGGTTGTCGGCGGCACGCGGCGGCTGTCGCTG
CCCGATGGCGGCACGCTCGACGTGCGGATTCCCCCCGGCACCGAGGACGGGCAACTGTTGCGCCTGCGCGGCAAGGGCGGGGTGGGATGG
AATGGCGGGCCTGCGGGCGATGCGCTGATCCGCGTCAGCGTGGCGCCGCATCGCTTCTTCACCCGCGAAGGGCAGGATATCCGGCTCGAT
CTGCCGGTGACGCTGGCCGAGGCGGTGCTGGGCGGGCAGGTCGAGGTGCCGACGCCGGGCGGCGCGGTGCGGATGCGGATTCCCGCGGGC
TCGGACAGCGGCACGGTGCTGCGGCTGCGCGGGCGCGGCGTGCCGGCGCATGGCGCCGCCGCCGCGGGCGATCTCTATGCCACGCTGCGC
GTTGTGATTGGCAAGTCTGACCCGGCGCTGGAAACCTTCCTGCGCGGCTGGACGCCGGAGGAGACGCCCGATCCGCGCGCCGGGATGACG
GAGACGGAGGTGCCGCCATGA

Gene Information
Molecule Type genomic DNA
Bases 921 Bases
Molecular Weight286257.4 Da
Coding Sequence CP000697.1:3276800..3277720
NCBI ReferenceABQ32182
NotesPFAM: heat shock protein DnaJ domain protein;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 3 to 65 63 N-terminal DnaJ domain PF00226
G/F-rich region 107 to 124 18 Glycine-phenylalanine rich region Manually identified
C-terminal domain 168 to 284 117 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCR2

Accession Number

HSP40_0015

Added on

2012-02-02

Updated On

2014-01-20