Help  Custom Search
 
Chaperone protein DnaJ of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein DnaJ

Synonymous Names

DNAJ_ACICJ, Hsp40/J-protein, DnaJ

Gene names

Gene Name

dnaJ

Gene Locus Tag

Acry_1645

Gene Identifier

5161921

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MAKTDYYELLGVSRGASADELKKAYRKLAMQYHPDRNPGDAAAEQKFKDINEAYDVLKDEQKRAAYDRFG HAAFENGGGPGAGGFGGGFGGFGGFEGGIGDIFEQMFGEAMGGRRGGRTERAGADLRAAVEIDLTQAFTG TKTEIRVPTRVSCDACSGTGSADKSAANDTCPTCGGAGRVRAQQGFFVVERTCPTCGGAGRTVRNPCRVC SGAGTVPRERTLSVTIPAGVEDGTRIRLSGEGEAGGRGASPGDLYVHVSIRPHPIFQRDGANVFCRVPLR MAQAALGGEIEVPAIDGTRARVKIPAGTQTGDQFRLRGKGFSVLRSTARGDMYIQVAVETPQNLTKRQRE LLEEFEREAGNTASGSPEHEGFFAKVKEFFDGL

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCGAAGACGGATTATTACGAACTTCTCGGCGTGTCGCGGGGCGCTTCGGCCGATGAGCTGAAGAAGGCCTATCGCAAGCTGGCGAT
GCAGTACCACCCGGACCGCAACCCGGGCGACGCCGCGGCCGAGCAGAAATTCAAGGACATCAACGAAGCCTACGACGTCCTCAAGGACGA
GCAGAAGCGCGCCGCCTATGACCGCTTCGGCCATGCCGCGTTCGAGAATGGCGGCGGGCCGGGGGCCGGCGGCTTTGGCGGCGGCTTCGG
CGGCTTCGGCGGGTTCGAGGGCGGCATCGGCGACATTTTCGAGCAGATGTTCGGCGAGGCGATGGGCGGTCGCCGCGGTGGCCGCACCGA
GCGCGCGGGCGCCGACCTGCGCGCCGCCGTCGAGATCGACCTGACCCAGGCCTTCACCGGCACCAAGACCGAGATCCGCGTGCCCACGCG
CGTGTCCTGCGATGCCTGTTCGGGCACCGGCTCGGCCGACAAGTCCGCCGCGAACGACACCTGCCCGACCTGTGGCGGCGCCGGCAGGGT
GCGCGCCCAGCAGGGCTTCTTCGTCGTCGAGCGCACCTGCCCGACCTGCGGTGGCGCCGGCCGCACCGTGCGCAATCCCTGCCGGGTCTG
CTCCGGCGCCGGCACCGTGCCGCGCGAGCGCACGCTCTCGGTCACCATTCCCGCCGGCGTCGAGGACGGCACGCGCATCCGCCTCTCCGG
CGAGGGCGAGGCCGGCGGCCGCGGCGCGTCGCCCGGCGATCTCTACGTTCATGTCTCGATCCGCCCGCACCCGATCTTCCAGCGCGATGG
CGCCAACGTGTTCTGCCGTGTGCCGCTGCGCATGGCCCAGGCCGCCCTCGGCGGCGAGATCGAGGTTCCGGCGATCGACGGCACGCGCGC
CCGCGTCAAGATCCCCGCCGGCACCCAGACGGGCGACCAGTTCCGCCTGCGCGGCAAGGGGTTCTCGGTGCTGCGCAGCACGGCGCGGGG
CGACATGTATATCCAGGTCGCGGTCGAGACGCCGCAGAATCTGACGAAGCGCCAGCGCGAACTGCTCGAGGAGTTCGAGCGCGAGGCCGG
CAACACCGCCTCCGGCAGCCCGGAACACGAGGGATTCTTCGCCAAGGTGAAGGAATTCTTCGACGGGCTGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine17616 %
Guanine40736 %
Thyamine16014 %
Cytosine40936 %
A+T33630 %
G+C81671 %

Total Bases :   1152 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC18523
GGCGGCGGC25533
GCGCGC35923
GCGCGC37723
CGCGCG44523
GCGCGC53923
TCGTCGTCG55933
CGCGCG64923
CGCGCG89223

Microsatellite Map

ATGGCGAAGACGGATTATTACGAACTTCTCGGCGTGTCGCGGGGCGCTTCGGCCGATGAGCTGAAGAAGGCCTATCGCAAGCTGGCGATG
CAGTACCACCCGGACCGCAACCCGGGCGACGCCGCGGCCGAGCAGAAATTCAAGGACATCAACGAAGCCTACGACGTCCTCAAGGACGAG
CAGAAGCGCGCCGCCTATGACCGCTTCGGCCATGCCGCGTTCGAGAATGGCGGCGGGCCGGGGGCCGGCGGCTTTGGCGGCGGCTTCGGC
GGCTTCGGCGGGTTCGAGGGCGGCATCGGCGACATTTTCGAGCAGATGTTCGGCGAGGCGATGGGCGGTCGCCGCGGTGGCCGCACCGAG
CGCGCGGGCGCCGACCTGCGCGCCGCCGTCGAGATCGACCTGACCCAGGCCTTCACCGGCACCAAGACCGAGATCCGCGTGCCCACGCGC
GTGTCCTGCGATGCCTGTTCGGGCACCGGCTCGGCCGACAAGTCCGCCGCGAACGACACCTGCCCGACCTGTGGCGGCGCCGGCAGGGTG
CGCGCCCAGCAGGGCTTCTTCGTCGTCGAGCGCACCTGCCCGACCTGCGGTGGCGCCGGCCGCACCGTGCGCAATCCCTGCCGGGTCTGC
TCCGGCGCCGGCACCGTGCCGCGCGAGCGCACGCTCTCGGTCACCATTCCCGCCGGCGTCGAGGACGGCACGCGCATCCGCCTCTCCGGC
GAGGGCGAGGCCGGCGGCCGCGGCGCGTCGCCCGGCGATCTCTACGTTCATGTCTCGATCCGCCCGCACCCGATCTTCCAGCGCGATGGC
GCCAACGTGTTCTGCCGTGTGCCGCTGCGCATGGCCCAGGCCGCCCTCGGCGGCGAGATCGAGGTTCCGGCGATCGACGGCACGCGCGCC
CGCGTCAAGATCCCCGCCGGCACCCAGACGGGCGACCAGTTCCGCCTGCGCGGCAAGGGGTTCTCGGTGCTGCGCAGCACGGCGCGGGGC
GACATGTATATCCAGGTCGCGGTCGAGACGCCGCAGAATCTGACGAAGCGCCAGCGCGAACTGCTCGAGGAGTTCGAGCGCGAGGCCGGC
AACACCGCCTCCGGCAGCCCGGAACACGAGGGATTCTTCGCCAAGGTGAAGGAATTCTTCGACGGGCTGTGA

Gene Information
Molecule Type genomic DNA
Bases 1152 Bases
Molecular Weight355998.09 Da
Coding Sequence complement(CP000697.1:1817014..1818165)
NCBI ReferenceABQ30850
NotesTIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 5 to 67 63 N-terminal DnaJ domain PF00226
G/F-rich region 77 to 100 24 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 140 to 221 82 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 234 to 356 123 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACCR1

Accession Number

HSP40_0014

Added on

2012-02-02

Updated On

2014-01-20