Help  Custom Search
 
molecular chaperone DnaJ of Acholeplasma laidlawii str. PG-8A

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

molecular chaperone DnaJ

Synonymous Names

A9NFN9_ACHLI, Hsp40/J-protein, DnaJ

Gene names

Gene Name

dnaJ

Gene Locus Tag

ACL_0551

Gene Identifier

5803266

Taxon Information

Organism

Acholeplasma laidlawii str. PG-8A

Organism ID

441768 [NCBI] [UNIPROT]

Lineage

Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Acholeplasma; Acholeplasma laidlawii PG-8A

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MAKRDYYDVLGISKSASQDEIKKAYRSLAKKYHPDVSKEKDAETKFKEVQEAYDVLNDSNKKAQYDRFGH AGTGQDPFGGAGGGFGGFGGFDDIISQFFGGGQTRRTRQTSNVGEDLNMRMTIDFMEAVLGTTKNVSVDI TQDCGHCHGSGAESSKDVHTCSKCHGQGFINVDQRTMFGTMRSQQVCPQCQGEGQTIDNKCHVCSGAGRV KAKKTVDVKVPAGVDNEMTLRVPGYGNGGRKGAESGDLYITFRVKPHKIFKRRGSDIILDVPITFTQAAL GDKIDIPTIYGEVELTIPAGIQSGTELKLKNKGTKDPRTGKTGDQHVIVNIETPKNLSSEEKKLFEQLSK LDSPRKKSGWDKFKSFFTN

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCAAAAAGAGATTATTATGATGTGCTAGGTATATCAAAAAGTGCATCTCAAGACGAAATTAAAAAAGCTTACAGAAGTTTAGCTAA
AAAATATCACCCTGACGTTTCAAAGGAAAAAGATGCTGAAACAAAATTTAAAGAAGTTCAAGAAGCCTATGATGTCTTAAATGATTCAAA
TAAAAAAGCACAATACGATAGATTTGGTCATGCTGGTACTGGACAAGATCCATTTGGTGGTGCTGGTGGTGGTTTTGGCGGATTTGGTGG
CTTTGATGACATTATTAGCCAATTCTTTGGTGGTGGACAAACACGTAGAACACGTCAAACATCAAATGTTGGTGAAGACTTAAATATGCG
TATGACCATCGATTTTATGGAAGCAGTTTTAGGTACAACAAAAAATGTTTCTGTAGATATCACTCAAGATTGTGGTCACTGTCATGGCTC
TGGTGCAGAAAGTTCAAAAGACGTTCATACCTGTAGCAAATGTCATGGTCAAGGATTTATTAACGTAGACCAACGTACCATGTTTGGTAC
AATGAGAAGTCAACAAGTATGTCCACAATGTCAAGGTGAAGGGCAAACAATTGATAACAAATGTCATGTTTGTTCCGGTGCTGGACGTGT
TAAGGCTAAAAAGACAGTGGATGTGAAAGTACCTGCTGGTGTCGATAATGAAATGACATTACGCGTACCAGGTTATGGTAATGGTGGTAG
AAAAGGTGCTGAATCAGGTGACCTATACATCACATTTAGAGTGAAACCACATAAAATATTTAAACGTCGTGGTTCAGATATCATTTTAGA
TGTACCTATTACATTTACGCAAGCTGCACTTGGAGACAAAATTGATATACCAACTATTTATGGTGAAGTAGAGTTAACCATACCTGCAGG
TATTCAATCTGGTACTGAACTTAAATTAAAAAATAAGGGAACAAAAGATCCAAGAACTGGTAAGACAGGTGATCAACATGTTATCGTCAA
TATTGAGACACCTAAAAACTTATCTAGTGAGGAAAAGAAATTATTTGAACAGTTAAGTAAACTGGATTCCCCAAGAAAGAAATCTGGTTG
GGATAAATTCAAATCATTCTTTACAAATTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine40037 %
Guanine23622 %
Thyamine30928 %
Cytosine16515 %
A+T70964 %
G+C40137 %

Total Bases :   1110 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA6323
AAAAAA8723
AAAAAA18023
TGGTGGTGG24233
TGGTGGTGG29633
AAAAAA39823
AAAAAA92623

Microsatellite Map

ATGGCAAAAAGAGATTATTATGATGTGCTAGGTATATCAAAAAGTGCATCTCAAGACGAAATTAAAAAAGCTTACAGAAGTTTAGCTAAA
AAATATCACCCTGACGTTTCAAAGGAAAAAGATGCTGAAACAAAATTTAAAGAAGTTCAAGAAGCCTATGATGTCTTAAATGATTCAAAT
AAAAAAGCACAATACGATAGATTTGGTCATGCTGGTACTGGACAAGATCCATTTGGTGGTGCTGGTGGTGGTTTTGGCGGATTTGGTGGC
TTTGATGACATTATTAGCCAATTCTTTGGTGGTGGACAAACACGTAGAACACGTCAAACATCAAATGTTGGTGAAGACTTAAATATGCGT
ATGACCATCGATTTTATGGAAGCAGTTTTAGGTACAACAAAAAATGTTTCTGTAGATATCACTCAAGATTGTGGTCACTGTCATGGCTCT
GGTGCAGAAAGTTCAAAAGACGTTCATACCTGTAGCAAATGTCATGGTCAAGGATTTATTAACGTAGACCAACGTACCATGTTTGGTACA
ATGAGAAGTCAACAAGTATGTCCACAATGTCAAGGTGAAGGGCAAACAATTGATAACAAATGTCATGTTTGTTCCGGTGCTGGACGTGTT
AAGGCTAAAAAGACAGTGGATGTGAAAGTACCTGCTGGTGTCGATAATGAAATGACATTACGCGTACCAGGTTATGGTAATGGTGGTAGA
AAAGGTGCTGAATCAGGTGACCTATACATCACATTTAGAGTGAAACCACATAAAATATTTAAACGTCGTGGTTCAGATATCATTTTAGAT
GTACCTATTACATTTACGCAAGCTGCACTTGGAGACAAAATTGATATACCAACTATTTATGGTGAAGTAGAGTTAACCATACCTGCAGGT
ATTCAATCTGGTACTGAACTTAAATTAAAAAATAAGGGAACAAAAGATCCAAGAACTGGTAAGACAGGTGATCAACATGTTATCGTCAAT
ATTGAGACACCTAAAAACTTATCTAGTGAGGAAAAGAAATTATTTGAACAGTTAAGTAAACTGGATTCCCCAAGAAAGAAATCTGGTTGG
GATAAATTCAAATCATTCTTTACAAATTAA

Gene Information
Molecule Type genomic DNA
Bases 1110 Bases
Molecular Weight344628.1 Da
Coding Sequence CP000896.1:587547..588656
NCBI ReferenceABX81169
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 5 to 66 62 N-terminal DnaJ domain PF00226
G/F-rich region 78 to 102 25 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 131 to 215 85 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 228 to 349 122 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACLA1

Accession Number

HSP40_0013

Added on

2012-02-02

Updated On

2014-01-20