Help  Custom Search
 
DnaJ-like protein, putative of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ-like protein, putative

Synonymous Names

B0C7K8_ACAM1, Hsp40/J-protein

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MDIADCYRLLQLTSRANIEDLKASYRRLARQWHPDTNPGDQLAHEKFIQVTEAYKTLQKIVPPAPNNSTV PASVPSRATAKPRSAPSVKVSTQSTKPSSPPPPQQPQRQARPQAATSRPRATVSKQPTPQPKPATSTRKS SLSPADIKLKVDSYKQLQELIQRQRFPRAVALIEALAQRLPQDAEVRQWQAIIYQSWGRQLIRERKLNQA RAYLKKALNTDPHNKALWAEIELDFKKIEMAF

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGATATCGCAGACTGCTATCGCCTGCTACAACTGACTTCTAGAGCCAATATAGAAGACCTCAAAGCCTCATATCGTCGACTAGCAAG
GCAATGGCACCCGGATACCAATCCGGGCGATCAACTCGCCCATGAGAAATTTATTCAGGTTACTGAGGCTTACAAAACGCTGCAAAAAAT
TGTCCCTCCTGCCCCGAATAACAGCACAGTTCCTGCATCTGTTCCATCCAGAGCAACAGCAAAGCCCCGTTCTGCCCCCTCAGTCAAGGT
CTCGACCCAGTCGACAAAACCTTCTTCGCCCCCGCCTCCACAACAGCCTCAACGTCAGGCTCGACCTCAAGCTGCGACATCCAGGCCACG
AGCAACGGTTTCTAAACAGCCCACCCCCCAACCCAAGCCTGCCACTTCCACTAGAAAATCCTCCCTTTCACCCGCAGACATCAAGCTGAA
GGTGGATTCTTATAAGCAACTTCAAGAATTAATTCAGCGCCAGAGATTTCCCAGAGCCGTTGCCCTTATTGAAGCCCTGGCCCAACGTCT
CCCCCAGGATGCGGAAGTGAGACAATGGCAGGCTATTATTTACCAATCCTGGGGACGGCAGCTCATCCGGGAACGAAAACTCAATCAGGC
TAGAGCTTATCTTAAGAAGGCATTGAATACGGATCCTCACAATAAGGCTCTTTGGGCTGAAATTGAGCTGGACTTTAAGAAAATAGAAAT
GGCGTTCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine20929 %
Guanine14621 %
Thyamine15221 %
Cytosine22231 %
A+T36150 %
G+C36851 %

Total Bases :   729 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA17223
CCCCCC38223

Microsatellite Map

ATGGATATCGCAGACTGCTATCGCCTGCTACAACTGACTTCTAGAGCCAATATAGAAGACCTCAAAGCCTCATATCGTCGACTAGCAAGG
CAATGGCACCCGGATACCAATCCGGGCGATCAACTCGCCCATGAGAAATTTATTCAGGTTACTGAGGCTTACAAAACGCTGCAAAAAATT
GTCCCTCCTGCCCCGAATAACAGCACAGTTCCTGCATCTGTTCCATCCAGAGCAACAGCAAAGCCCCGTTCTGCCCCCTCAGTCAAGGTC
TCGACCCAGTCGACAAAACCTTCTTCGCCCCCGCCTCCACAACAGCCTCAACGTCAGGCTCGACCTCAAGCTGCGACATCCAGGCCACGA
GCAACGGTTTCTAAACAGCCCACCCCCCAACCCAAGCCTGCCACTTCCACTAGAAAATCCTCCCTTTCACCCGCAGACATCAAGCTGAAG
GTGGATTCTTATAAGCAACTTCAAGAATTAATTCAGCGCCAGAGATTTCCCAGAGCCGTTGCCCTTATTGAAGCCCTGGCCCAACGTCTC
CCCCAGGATGCGGAAGTGAGACAATGGCAGGCTATTATTTACCAATCCTGGGGACGGCAGCTCATCCGGGAACGAAAACTCAATCAGGCT
AGAGCTTATCTTAAGAAGGCATTGAATACGGATCCTCACAATAAGGCTCTTTGGGCTGAAATTGAGCTGGACTTTAAGAAAATAGAAATG
GCGTTCTAA

Gene Information
Molecule Type genomic DNA
Bases 729 Bases
Molecular Weight223899.95 Da
Coding Sequence complement(CP000828.1:185998..186726)
NCBI ReferenceABW25268
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 5 to 61 57 N-terminal DnaJ domain PF00226

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA12

Accession Number

HSP40_0012

Added on

2012-02-02

Updated On

2014-01-20