Help  Custom Search
 
hypothetical protein AM1_3555 of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

hypothetical protein AM1_3555

Synonymous Names

B0C293_ACAM1, Hsp40/J-protein, Putative uncharacterized protein

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MPNLNECYRTLELRVGASLEEVNQAYKDLVFIWHPDRIPQSRERLQQKAIVKLQDLNEARDYLQSYLQRR QNLRSARRPAQKAAAAGQARSASSSAPAKTTRRTAPPRTTQKPKERPSQAAQKFRQRTKATQPPPRSVPK PKTQKAAPPQSKPPQPPAATDSAAKRAAKRWRTGRAEAPAKTAPAATKSTSRPLTPDHSGVDWHGADLQE RDFSGRNLSQANLANVNLKDAFMHKVNLAGANLTNANLTRANLLQANLTQANLQGANLTAADLSGADLRG ADFTGANMGIGKKVMVKLTGANLSGAIMPNGTIHT

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCCAAACCTCAATGAATGCTATCGCACCTTAGAGTTGAGGGTTGGCGCGTCTTTAGAAGAGGTCAATCAAGCCTACAAAGACTTAGT
CTTTATTTGGCACCCCGATCGTATTCCCCAAAGCCGCGAGCGTTTGCAGCAAAAAGCCATCGTCAAGCTACAAGATCTCAACGAAGCTCG
TGACTATCTGCAATCCTATCTGCAACGACGTCAAAACTTGCGGTCAGCCCGTCGCCCGGCTCAGAAAGCAGCGGCAGCAGGCCAGGCCCG
ATCGGCCAGCTCGTCTGCTCCTGCAAAAACGACAAGACGCACGGCTCCACCCCGCACCACTCAAAAGCCTAAAGAGCGACCATCCCAAGC
TGCTCAAAAGTTTCGGCAGCGTACTAAGGCAACTCAACCCCCGCCTAGATCTGTTCCTAAGCCTAAGACGCAAAAGGCTGCTCCGCCCCA
AAGTAAGCCTCCTCAGCCACCTGCTGCAACCGATTCTGCTGCTAAACGAGCTGCTAAACGTTGGCGTACAGGTCGAGCTGAAGCGCCTGC
TAAAACAGCTCCTGCAGCAACTAAGTCTACCTCGCGCCCTCTGACGCCAGACCACAGTGGTGTCGATTGGCACGGTGCTGATCTACAAGA
GCGGGATTTCTCAGGGCGCAATCTGAGTCAAGCTAATTTAGCGAATGTCAATCTCAAAGATGCATTTATGCATAAGGTGAATCTGGCGGG
TGCTAATTTGACAAATGCCAATTTGACCCGTGCCAATCTACTCCAAGCCAACCTCACCCAGGCCAACTTGCAAGGCGCTAATCTGACCGC
TGCAGATTTAAGTGGCGCTGATTTGCGAGGGGCAGATTTTACCGGGGCCAATATGGGTATCGGCAAAAAAGTGATGGTCAAACTAACGGG
TGCTAATCTCTCTGGGGCGATTATGCCTAACGGCACAATCCATACCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine25628 %
Guanine22124 %
Thyamine19521 %
Cytosine27630 %
A+T45148 %
G+C49753 %

Total Bases :   948 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA87323
TCTCTC90523

Microsatellite Map

ATGCCAAACCTCAATGAATGCTATCGCACCTTAGAGTTGAGGGTTGGCGCGTCTTTAGAAGAGGTCAATCAAGCCTACAAAGACTTAGTC
TTTATTTGGCACCCCGATCGTATTCCCCAAAGCCGCGAGCGTTTGCAGCAAAAAGCCATCGTCAAGCTACAAGATCTCAACGAAGCTCGT
GACTATCTGCAATCCTATCTGCAACGACGTCAAAACTTGCGGTCAGCCCGTCGCCCGGCTCAGAAAGCAGCGGCAGCAGGCCAGGCCCGA
TCGGCCAGCTCGTCTGCTCCTGCAAAAACGACAAGACGCACGGCTCCACCCCGCACCACTCAAAAGCCTAAAGAGCGACCATCCCAAGCT
GCTCAAAAGTTTCGGCAGCGTACTAAGGCAACTCAACCCCCGCCTAGATCTGTTCCTAAGCCTAAGACGCAAAAGGCTGCTCCGCCCCAA
AGTAAGCCTCCTCAGCCACCTGCTGCAACCGATTCTGCTGCTAAACGAGCTGCTAAACGTTGGCGTACAGGTCGAGCTGAAGCGCCTGCT
AAAACAGCTCCTGCAGCAACTAAGTCTACCTCGCGCCCTCTGACGCCAGACCACAGTGGTGTCGATTGGCACGGTGCTGATCTACAAGAG
CGGGATTTCTCAGGGCGCAATCTGAGTCAAGCTAATTTAGCGAATGTCAATCTCAAAGATGCATTTATGCATAAGGTGAATCTGGCGGGT
GCTAATTTGACAAATGCCAATTTGACCCGTGCCAATCTACTCCAAGCCAACCTCACCCAGGCCAACTTGCAAGGCGCTAATCTGACCGCT
GCAGATTTAAGTGGCGCTGATTTGCGAGGGGCAGATTTTACCGGGGCCAATATGGGTATCGGCAAAAAAGTGATGGTCAAACTAACGGGT
GCTAATCTCTCTGGGGCGATTATGCCTAACGGCACAATCCATACCTAA

Gene Information
Molecule Type genomic DNA
Bases 948 Bases
Molecular Weight292007.89 Da
Coding Sequence CP000828.1:3597997..3598944
NCBI ReferenceABW28545
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 6 to 72 67 N-terminal DnaJ domain PF00226
Pentapeptide 221 to 305 85 Pentapeptide repeat PF00805

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA10

Accession Number

HSP40_0010

Added on

2012-02-02

Updated On

2014-01-20