Help  Custom Search
 
DnaJ domain-containing protein of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ domain-containing protein

Synonymous Names

B0C6G2_ACAM1, Hsp40/J-protein, DnaJ domain protein

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MRIPLDLYQILGVPIQATPEQIEQAFADRCQQLPRQEYSKTAIAARTQLLQDAHAVLSDSNARTAYDQSI LAESAPPDIGSMELQESQLVGALLLLQEQSDYERIAQLGAEYLKRSIDLNRLPSANNGSDEDVILAMALA NLEAGRECWQQKQFEKASDVLQSGLKLLTQEQLFPAVQREIELDLYKLRPYRILGLLAEPEENLTKRQQG FSLLQIMLDERGGIDGPQDDLSGLSVDDFLRFIQQLRCHLTVQEQQDLFIKESERPSAVASYLLVYALVA KGCSQGKPEFIQQAKSALTELADRQDIQVEKSMCYLLLGQPGAAIQTLPLSRDQESLEFIHQYSEGAEDL VPGLFLYTERWLQQEVYPYFRDLNDTQLSLQNYFNDEHIQAYLNGLAPEPVSPRMPASTTSTDLPLLAKQ GSETLGSAREGRLPSQAAHRQESKRQRPPGKPPVSAKKVTPLTPVKGLDSPRKRSSMPAATAPAPKAESL QTNDAGRGNQGASKTRRSRSQLQYRRWFFAAGAVALVLFALFGLISQCSRPEDPVPGAENPASEPASPDP IPSPASPSVSPTASPPVASPTPAPATATSEEITTTSARQIIQSWQSAKAEAMGKDHQIASLDKILAEPSL SEWKAGAQSDQLNQIHLEYTFDDLKINAIKQQSPTEATVEATVTETAKVFEGGQQTTDAYTGDTYRVRYQ LVREQDQWKIKQMQVLN

FASTA Format Composition Secondary Structure

Nucleotide
 GTGCGTATTCCTTTAGACTTATATCAAATATTGGGTGTGCCAATTCAAGCGACACCAGAGCAGATTGAACAGGCATTTGCCGATCGTTG
TCAGCAGCTCCCCCGTCAAGAGTACTCTAAAACAGCAATTGCAGCCCGCACACAGCTATTGCAAGATGCCCATGCTGTACTCTCTGATTC
CAACGCACGCACTGCCTATGACCAGTCTATTTTAGCGGAATCTGCCCCTCCGGATATAGGGAGTATGGAACTGCAAGAATCTCAGTTGGT
TGGTGCTTTATTGCTTTTGCAGGAGCAAAGTGATTATGAGCGAATCGCTCAATTAGGAGCCGAATATCTAAAGCGTTCAATTGATCTCAA
TCGCTTGCCGTCTGCGAATAATGGGTCTGATGAAGATGTCATCTTAGCGATGGCGTTAGCGAATTTAGAAGCGGGACGAGAATGTTGGCA
GCAAAAGCAGTTTGAAAAGGCTTCAGACGTTTTGCAGTCTGGTTTGAAGTTGCTAACACAAGAGCAGTTGTTTCCTGCAGTACAGCGAGA
AATTGAGCTGGATTTATACAAGCTTCGCCCCTATCGTATTTTGGGATTACTGGCTGAGCCTGAAGAGAATCTAACCAAACGTCAGCAAGG
CTTTTCTCTTCTTCAAATTATGTTAGATGAACGAGGGGGGATCGACGGGCCGCAAGATGATTTATCGGGATTGAGTGTTGACGATTTTCT
GCGATTTATTCAGCAATTACGGTGTCATTTAACGGTACAAGAACAGCAAGATCTCTTTATAAAAGAGAGTGAACGCCCGTCTGCGGTGGC
GAGTTACTTATTGGTTTATGCATTGGTTGCTAAGGGCTGTTCCCAGGGGAAGCCAGAGTTTATTCAACAGGCAAAATCGGCGTTGACGGA
GTTGGCTGATCGGCAGGATATTCAAGTCGAAAAGTCAATGTGCTATTTGTTGTTAGGCCAGCCGGGGGCTGCGATTCAGACACTTCCCTT
GAGTCGGGACCAAGAGTCATTAGAGTTTATTCATCAGTACTCTGAAGGGGCTGAAGATTTAGTTCCAGGCTTGTTCTTATATACAGAACG
TTGGTTACAGCAGGAAGTGTATCCCTATTTCAGGGATCTTAATGATACCCAATTGTCTTTGCAGAACTATTTCAATGATGAACATATTCA
GGCGTATCTCAATGGATTAGCACCGGAGCCTGTGTCGCCTCGGATGCCAGCTTCAACAACATCTACAGATTTACCGTTATTAGCCAAGCA
GGGAAGTGAAACCCTAGGCTCTGCTCGAGAAGGACGTCTTCCTTCCCAGGCTGCCCATCGTCAAGAGTCAAAACGTCAAAGACCCCCAGG
AAAACCGCCAGTATCGGCGAAAAAGGTTACGCCTTTAACTCCGGTGAAGGGACTAGATAGTCCTCGAAAACGATCTTCCATGCCAGCCGC
GACTGCCCCTGCACCTAAGGCTGAGTCTTTGCAGACGAATGATGCTGGTCGAGGAAATCAAGGTGCTTCCAAAACTCGACGTTCGCGATC
GCAACTGCAATACCGTCGATGGTTCTTTGCAGCGGGAGCTGTCGCACTGGTTTTATTCGCCTTATTTGGTCTTATCAGTCAGTGCTCTCG
CCCAGAAGATCCAGTCCCAGGTGCAGAGAATCCAGCTTCTGAACCGGCCAGCCCTGACCCCATTCCTTCTCCTGCAAGCCCCAGTGTTAG
CCCGACTGCTAGTCCGCCAGTGGCTAGCCCCACACCTGCTCCTGCGACAGCTACTAGCGAAGAAATCACGACAACGAGTGCTCGGCAAAT
TATTCAGTCTTGGCAATCGGCAAAAGCTGAGGCAATGGGCAAAGATCACCAAATTGCGTCTCTGGATAAAATTTTGGCGGAGCCCAGCTT
GTCTGAATGGAAGGCTGGTGCTCAGTCGGATCAACTGAATCAGATTCACTTGGAATATACCTTTGATGATCTGAAAATTAATGCGATTAA
GCAGCAAAGCCCTACTGAAGCTACGGTTGAGGCAACGGTGACCGAGACGGCGAAGGTCTTCGAAGGTGGACAACAGACAACGGATGCCTA
TACGGGAGATACTTATCGTGTCCGCTATCAGCTTGTTCGAGAACAAGATCAGTGGAAGATCAAGCAAATGCAGGTACTGAACTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine57327 %
Guanine53825 %
Thyamine54926 %
Cytosine49423 %
A+T112253 %
G+C103248 %

Total Bases :   2154 bases

Microsatellites
SequencePosition LengthRepeats
CACACA13723
CTCTCT16823
GGGGGG66323
AGAGAG78223
TATATA106623

Microsatellite Map

GTGCGTATTCCTTTAGACTTATATCAAATATTGGGTGTGCCAATTCAAGCGACACCAGAGCAGATTGAACAGGCATTTGCCGATCGTTGT
CAGCAGCTCCCCCGTCAAGAGTACTCTAAAACAGCAATTGCAGCCCGCACACAGCTATTGCAAGATGCCCATGCTGTACTCTCTGATTCC
AACGCACGCACTGCCTATGACCAGTCTATTTTAGCGGAATCTGCCCCTCCGGATATAGGGAGTATGGAACTGCAAGAATCTCAGTTGGTT
GGTGCTTTATTGCTTTTGCAGGAGCAAAGTGATTATGAGCGAATCGCTCAATTAGGAGCCGAATATCTAAAGCGTTCAATTGATCTCAAT
CGCTTGCCGTCTGCGAATAATGGGTCTGATGAAGATGTCATCTTAGCGATGGCGTTAGCGAATTTAGAAGCGGGACGAGAATGTTGGCAG
CAAAAGCAGTTTGAAAAGGCTTCAGACGTTTTGCAGTCTGGTTTGAAGTTGCTAACACAAGAGCAGTTGTTTCCTGCAGTACAGCGAGAA
ATTGAGCTGGATTTATACAAGCTTCGCCCCTATCGTATTTTGGGATTACTGGCTGAGCCTGAAGAGAATCTAACCAAACGTCAGCAAGGC
TTTTCTCTTCTTCAAATTATGTTAGATGAACGAGGGGGGATCGACGGGCCGCAAGATGATTTATCGGGATTGAGTGTTGACGATTTTCTG
CGATTTATTCAGCAATTACGGTGTCATTTAACGGTACAAGAACAGCAAGATCTCTTTATAAAAGAGAGTGAACGCCCGTCTGCGGTGGCG
AGTTACTTATTGGTTTATGCATTGGTTGCTAAGGGCTGTTCCCAGGGGAAGCCAGAGTTTATTCAACAGGCAAAATCGGCGTTGACGGAG
TTGGCTGATCGGCAGGATATTCAAGTCGAAAAGTCAATGTGCTATTTGTTGTTAGGCCAGCCGGGGGCTGCGATTCAGACACTTCCCTTG
AGTCGGGACCAAGAGTCATTAGAGTTTATTCATCAGTACTCTGAAGGGGCTGAAGATTTAGTTCCAGGCTTGTTCTTATATACAGAACGT
TGGTTACAGCAGGAAGTGTATCCCTATTTCAGGGATCTTAATGATACCCAATTGTCTTTGCAGAACTATTTCAATGATGAACATATTCAG
GCGTATCTCAATGGATTAGCACCGGAGCCTGTGTCGCCTCGGATGCCAGCTTCAACAACATCTACAGATTTACCGTTATTAGCCAAGCAG
GGAAGTGAAACCCTAGGCTCTGCTCGAGAAGGACGTCTTCCTTCCCAGGCTGCCCATCGTCAAGAGTCAAAACGTCAAAGACCCCCAGGA
AAACCGCCAGTATCGGCGAAAAAGGTTACGCCTTTAACTCCGGTGAAGGGACTAGATAGTCCTCGAAAACGATCTTCCATGCCAGCCGCG
ACTGCCCCTGCACCTAAGGCTGAGTCTTTGCAGACGAATGATGCTGGTCGAGGAAATCAAGGTGCTTCCAAAACTCGACGTTCGCGATCG
CAACTGCAATACCGTCGATGGTTCTTTGCAGCGGGAGCTGTCGCACTGGTTTTATTCGCCTTATTTGGTCTTATCAGTCAGTGCTCTCGC
CCAGAAGATCCAGTCCCAGGTGCAGAGAATCCAGCTTCTGAACCGGCCAGCCCTGACCCCATTCCTTCTCCTGCAAGCCCCAGTGTTAGC
CCGACTGCTAGTCCGCCAGTGGCTAGCCCCACACCTGCTCCTGCGACAGCTACTAGCGAAGAAATCACGACAACGAGTGCTCGGCAAATT
ATTCAGTCTTGGCAATCGGCAAAAGCTGAGGCAATGGGCAAAGATCACCAAATTGCGTCTCTGGATAAAATTTTGGCGGAGCCCAGCTTG
TCTGAATGGAAGGCTGGTGCTCAGTCGGATCAACTGAATCAGATTCACTTGGAATATACCTTTGATGATCTGAAAATTAATGCGATTAAG
CAGCAAAGCCCTACTGAAGCTACGGTTGAGGCAACGGTGACCGAGACGGCGAAGGTCTTCGAAGGTGGACAACAGACAACGGATGCCTAT
ACGGGAGATACTTATCGTGTCCGCTATCAGCTTGTTCGAGAACAAGATCAGTGGAAGATCAAGCAAATGCAGGTACTGAACTAA

Gene Information
Molecule Type genomic DNA
Bases 2154 Bases
Molecular Weight666383.07 Da
Coding Sequence complement(CP000828.1:1327352..1329505)
NCBI ReferenceABW26383
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 6 to 67 62 N-terminal DnaJ domain PF00226
TMhelix 517 to 536 20 Transmembrane helix region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA8

Accession Number

HSP40_0008

Added on

2012-02-02

Updated On

2014-01-20