Help  Custom Search
 
DnaJ-like protein, putative of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ-like protein, putative

Synonymous Names

B0C9G1_ACAM1, Hsp40/J-protein

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MSFEMKHGLAIFDCPDHYASLGLSIGASKGEIRKRYFKIARSLHPDSCPADMDKAEASRMLSKLVNPAYE VLSQDKDLEEYKVLLRLVGQRANREVNPSSMQTPGAQELLTTSSFEERYQEQVQQLAQNQFENLDGILAV VSQLSELNLAYLIRREGTQKSGARGAQPMQARAAQAQPEAAARPETSVSPAPAEQSPPQEAATSQFVNDY CRRAEELIQKNRLNDAIVELRDALKLEPKNSRCHTLMGSIYLQKKSLKMAKVHFTQALNSDPQNAEAIKG KQKLEKLEKKAQPAAAKQAQAKQPERKKGLFGLFGGKK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTCATTTGAAATGAAGCATGGTCTTGCTATTTTCGATTGTCCGGATCACTATGCCAGCTTGGGTCTAAGCATTGGGGCGTCTAAGGG
GGAGATTCGCAAGCGCTACTTCAAAATTGCCCGAAGTTTGCATCCCGATAGTTGTCCAGCTGACATGGATAAGGCAGAAGCGAGTCGCAT
GCTCTCAAAGTTAGTGAATCCTGCCTATGAAGTCCTCTCACAAGATAAAGATTTGGAGGAATACAAAGTCTTACTCCGATTGGTCGGGCA
GCGGGCTAATCGTGAAGTGAATCCTAGTTCTATGCAAACGCCGGGTGCTCAGGAACTCTTAACGACCAGCTCTTTTGAAGAACGCTATCA
AGAACAGGTCCAACAACTCGCCCAAAACCAGTTTGAGAACTTGGACGGGATATTAGCGGTGGTGAGCCAGCTCAGTGAACTCAACCTGGC
CTATTTGATCCGCCGAGAAGGAACTCAGAAATCTGGAGCTAGAGGAGCGCAGCCTATGCAGGCTAGAGCAGCTCAAGCACAGCCGGAAGC
GGCGGCAAGGCCAGAAACATCTGTGTCTCCTGCGCCTGCAGAGCAGTCGCCTCCCCAAGAAGCGGCGACCTCGCAGTTTGTGAATGACTA
TTGCCGACGGGCGGAAGAACTGATTCAGAAAAACCGGTTGAATGACGCTATTGTAGAACTGCGCGATGCCCTCAAACTGGAACCCAAAAA
CAGTCGGTGCCATACGTTAATGGGGTCCATTTATCTACAGAAGAAGTCCCTCAAAATGGCCAAGGTGCATTTTACACAAGCCTTAAATAG
TGATCCACAGAATGCTGAAGCCATTAAAGGCAAGCAAAAATTGGAGAAATTAGAAAAGAAAGCGCAACCCGCTGCAGCAAAACAAGCTCA
AGCAAAGCAGCCGGAGCGTAAGAAGGGGCTGTTTGGTTTGTTTGGTGGTAAGAAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine28430 %
Guanine25027 %
Thyamine20522 %
Cytosine21823 %
A+T48952 %
G+C46849 %

Total Bases :   957 bases

Microsatellites
SequencePosition LengthRepeats

Microsatellite Map

ATGTCATTTGAAATGAAGCATGGTCTTGCTATTTTCGATTGTCCGGATCACTATGCCAGCTTGGGTCTAAGCATTGGGGCGTCTAAGGGG
GAGATTCGCAAGCGCTACTTCAAAATTGCCCGAAGTTTGCATCCCGATAGTTGTCCAGCTGACATGGATAAGGCAGAAGCGAGTCGCATG
CTCTCAAAGTTAGTGAATCCTGCCTATGAAGTCCTCTCACAAGATAAAGATTTGGAGGAATACAAAGTCTTACTCCGATTGGTCGGGCAG
CGGGCTAATCGTGAAGTGAATCCTAGTTCTATGCAAACGCCGGGTGCTCAGGAACTCTTAACGACCAGCTCTTTTGAAGAACGCTATCAA
GAACAGGTCCAACAACTCGCCCAAAACCAGTTTGAGAACTTGGACGGGATATTAGCGGTGGTGAGCCAGCTCAGTGAACTCAACCTGGCC
TATTTGATCCGCCGAGAAGGAACTCAGAAATCTGGAGCTAGAGGAGCGCAGCCTATGCAGGCTAGAGCAGCTCAAGCACAGCCGGAAGCG
GCGGCAAGGCCAGAAACATCTGTGTCTCCTGCGCCTGCAGAGCAGTCGCCTCCCCAAGAAGCGGCGACCTCGCAGTTTGTGAATGACTAT
TGCCGACGGGCGGAAGAACTGATTCAGAAAAACCGGTTGAATGACGCTATTGTAGAACTGCGCGATGCCCTCAAACTGGAACCCAAAAAC
AGTCGGTGCCATACGTTAATGGGGTCCATTTATCTACAGAAGAAGTCCCTCAAAATGGCCAAGGTGCATTTTACACAAGCCTTAAATAGT
GATCCACAGAATGCTGAAGCCATTAAAGGCAAGCAAAAATTGGAGAAATTAGAAAAGAAAGCGCAACCCGCTGCAGCAAAACAAGCTCAA
GCAAAGCAGCCGGAGCGTAAGAAGGGGCTGTTTGGTTTGTTTGGTGGTAAGAAATAA

Gene Information
Molecule Type genomic DNA
Bases 957 Bases
Molecular Weight296594.42 Da
Coding Sequence CP000828.1:4037767..4038723
NCBI ReferenceABW28974
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 16 to 82 67 N-terminal DnaJ domain PF00226
TPR 207 to 240 34 Tetratricopeptide repeat PF00515
TPR 241 to 274 34 Tetratricopeptide repeat PF00515

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA7

Accession Number

HSP40_0007

Added on

2012-02-02

Updated On

2014-01-20