Help  Custom Search
 
DnaJ domain-containing protein of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ domain-containing protein

Synonymous Names

B0CE81_ACAM1, Hsp40/J-protein, DnaJ domain protein

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MADLQPYFQLLRVSADVTPAELKAAFRRQARTCHPDLHPDNPAAEAEFQRLSEAYDIISEALYPPSPVDG FIHGDGSNGLTNAQALYARGTQKAAERDYIGAIQDYTRAIESDPEFLDAYLKRCQVRFVQGDDEGVLAEC AEILGLDDTVAQAYYYQGRARLQLGSAPAAIASYSQAISLDEDYAQAWLHRGRARLEMQEETLAREDLTK AAQLFEAQGEPDEVNRVQVILQEMGRSRRSKSEVKVQRQQLREQGLLQDIFTTIPEFFMNPSGGLLPTFA RLSARRATEVGLSYAGLSILGFVLAANLFPIVFSSVTLGERFILGAMPFFSLVFLNQLVRSLIRARGSWA SDIFISGATLLPLSLLMFLSGLVVQFGAAGVWILSFYLGCDSVLMLYVGCSQVNNLSEQNATLAVPTLLL ITSALTYGTFTIFAS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCGGATTTGCAACCTTACTTTCAATTGCTTCGAGTTTCAGCGGATGTAACGCCTGCAGAGCTTAAGGCTGCCTTTCGCCGTCAGGC
TAGAACCTGCCACCCTGATTTACACCCAGACAACCCTGCTGCTGAGGCTGAGTTTCAACGTTTGAGCGAAGCCTATGACATTATTTCTGA
AGCCCTCTATCCTCCTAGCCCAGTGGATGGATTTATTCATGGGGATGGCAGTAATGGTTTAACCAACGCTCAAGCATTGTATGCCCGAGG
GACTCAAAAGGCTGCTGAAAGAGACTATATAGGGGCTATTCAGGACTACACCCGAGCCATTGAATCCGATCCAGAATTCTTGGATGCCTA
CCTTAAACGGTGTCAGGTGCGGTTTGTTCAGGGGGATGACGAAGGGGTACTGGCAGAATGTGCGGAGATTTTAGGGTTAGATGATACGGT
TGCCCAGGCTTACTATTACCAGGGGCGAGCCCGATTGCAGTTAGGCTCTGCACCCGCTGCGATCGCATCCTATAGCCAAGCTATTTCTCT
AGATGAAGATTATGCCCAAGCCTGGTTGCACCGTGGACGGGCTCGTCTGGAAATGCAGGAAGAGACATTGGCCCGTGAAGACTTAACCAA
GGCCGCACAGCTTTTTGAAGCCCAAGGTGAGCCAGATGAAGTCAACCGAGTGCAGGTGATTTTGCAAGAGATGGGCCGGAGTCGTCGCTC
GAAATCTGAGGTTAAAGTCCAAAGACAGCAATTAAGAGAGCAAGGTCTCTTACAAGATATTTTTACGACGATTCCTGAGTTCTTTATGAA
CCCAAGTGGTGGATTGTTGCCCACCTTTGCCCGCTTGTCTGCTCGACGGGCTACTGAAGTGGGGTTAAGCTATGCGGGGCTGTCCATACT
GGGGTTTGTGTTAGCCGCTAACCTGTTTCCGATTGTCTTTAGTTCAGTCACTTTGGGCGAACGGTTTATACTCGGCGCGATGCCATTTTT
TAGCTTAGTTTTTTTGAATCAACTTGTTCGGAGTCTGATTCGTGCTCGGGGGAGTTGGGCCAGCGATATTTTTATCAGTGGGGCAACGCT
CTTGCCCCTGAGTTTGCTGATGTTTTTAAGTGGGCTGGTGGTTCAATTTGGGGCGGCTGGCGTTTGGATTTTATCCTTCTATCTGGGGTG
TGATTCGGTGTTGATGCTGTATGTGGGCTGCTCTCAAGTGAATAACTTGTCAGAGCAAAATGCTACATTGGCCGTTCCGACTCTATTATT
GATAACCAGTGCATTGACCTATGGCACTTTTACAATATTTGCTAGCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine29023 %
Guanine35628 %
Thyamine37629 %
Cytosine28622 %
A+T66651 %
G+C64250 %

Total Bases :   1308 bases

Microsatellites
SequencePosition LengthRepeats
CTGCTGCTG12433
TATATA29423
AGAGAG75323
TTTTTT98423
TTTTTT99723

Microsatellite Map

ATGGCGGATTTGCAACCTTACTTTCAATTGCTTCGAGTTTCAGCGGATGTAACGCCTGCAGAGCTTAAGGCTGCCTTTCGCCGTCAGGCT
AGAACCTGCCACCCTGATTTACACCCAGACAACCCTGCTGCTGAGGCTGAGTTTCAACGTTTGAGCGAAGCCTATGACATTATTTCTGAA
GCCCTCTATCCTCCTAGCCCAGTGGATGGATTTATTCATGGGGATGGCAGTAATGGTTTAACCAACGCTCAAGCATTGTATGCCCGAGGG
ACTCAAAAGGCTGCTGAAAGAGACTATATAGGGGCTATTCAGGACTACACCCGAGCCATTGAATCCGATCCAGAATTCTTGGATGCCTAC
CTTAAACGGTGTCAGGTGCGGTTTGTTCAGGGGGATGACGAAGGGGTACTGGCAGAATGTGCGGAGATTTTAGGGTTAGATGATACGGTT
GCCCAGGCTTACTATTACCAGGGGCGAGCCCGATTGCAGTTAGGCTCTGCACCCGCTGCGATCGCATCCTATAGCCAAGCTATTTCTCTA
GATGAAGATTATGCCCAAGCCTGGTTGCACCGTGGACGGGCTCGTCTGGAAATGCAGGAAGAGACATTGGCCCGTGAAGACTTAACCAAG
GCCGCACAGCTTTTTGAAGCCCAAGGTGAGCCAGATGAAGTCAACCGAGTGCAGGTGATTTTGCAAGAGATGGGCCGGAGTCGTCGCTCG
AAATCTGAGGTTAAAGTCCAAAGACAGCAATTAAGAGAGCAAGGTCTCTTACAAGATATTTTTACGACGATTCCTGAGTTCTTTATGAAC
CCAAGTGGTGGATTGTTGCCCACCTTTGCCCGCTTGTCTGCTCGACGGGCTACTGAAGTGGGGTTAAGCTATGCGGGGCTGTCCATACTG
GGGTTTGTGTTAGCCGCTAACCTGTTTCCGATTGTCTTTAGTTCAGTCACTTTGGGCGAACGGTTTATACTCGGCGCGATGCCATTTTTT
AGCTTAGTTTTTTTGAATCAACTTGTTCGGAGTCTGATTCGTGCTCGGGGGAGTTGGGCCAGCGATATTTTTATCAGTGGGGCAACGCTC
TTGCCCCTGAGTTTGCTGATGTTTTTAAGTGGGCTGGTGGTTCAATTTGGGGCGGCTGGCGTTTGGATTTTATCCTTCTATCTGGGGTGT
GATTCGGTGTTGATGCTGTATGTGGGCTGCTCTCAAGTGAATAACTTGTCAGAGCAAAATGCTACATTGGCCGTTCCGACTCTATTATTG
ATAACCAGTGCATTGACCTATGGCACTTTTACAATATTTGCTAGCTGA

Gene Information
Molecule Type genomic DNA
Bases 1308 Bases
Molecular Weight405052.38 Da
Coding Sequence CP000828.1:653201..654508
NCBI ReferenceABW25715
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 6 to 64 59 N-terminal DnaJ domain PF00226
TPR 83 to 116 34 Tetratricopeptide repeat PF00515
TPR 151 to 184 34 Tetratricopeptide repeat PF00515
TPR 185 to 218 34 Tetratricopeptide repeat PF00515
TMhelix 290 to 312 23 Transmembrane helix region Manually identified
TMhelix 322 to 339 18 Transmembrane helix region Manually identified
TMhelix 352 to 374 23 Transmembrane helix region Manually identified
TMhelix 378 to 400 23 Transmembrane helix region Manually identified
TMhelix 412 to 434 23 Transmembrane helix region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA6

Accession Number

HSP40_0006

Added on

2012-02-02

Updated On

2014-01-20