Help  Custom Search
 
DnaJ-like protein, putative of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ-like protein, putative

Synonymous Names

B0BYI4_ACAM1, Hsp40/J-protein

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MSGHNHYQTLEVDPAATPAEIKSAYRRLAKLFHPDSHHQMANHERIAQVNEAYEVLKDPHRRLAYDQHRR TAPTKGSWGNAQAGATRSQAYQKPTQTARTTEIHLQQWLKQVYTPVNRHLANILNPLADEIQCLSADPYD DDLMADFQDYLADCRTCLEKAQTIFQSFPNPGNIASVAAHLYYCLNHIEDGIEDLERFTYCYDDSYLTTG RELFRISKKLRNEAQDAIKAVF

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTCTGGTCATAATCACTACCAAACCCTAGAAGTCGATCCAGCTGCAACGCCAGCTGAGATCAAATCTGCCTATCGGCGTCTGGCTAA
GTTATTTCACCCCGATAGCCATCATCAGATGGCGAATCATGAGCGCATTGCTCAGGTGAATGAAGCTTACGAAGTTTTAAAAGATCCCCA
TCGACGGTTGGCCTATGACCAACATCGCCGTACGGCTCCCACCAAAGGTTCATGGGGAAATGCACAGGCTGGCGCTACCCGCAGTCAAGC
CTACCAAAAACCAACCCAAACTGCCCGCACAACAGAGATCCATCTCCAGCAATGGTTAAAGCAGGTGTACACACCTGTCAATCGGCACCT
GGCTAATATTCTTAACCCCCTAGCCGATGAAATCCAATGTTTATCTGCCGATCCCTATGACGATGATTTAATGGCAGATTTTCAGGATTA
CTTAGCCGATTGCCGGACTTGCCTAGAAAAGGCTCAAACGATCTTCCAATCTTTCCCGAATCCCGGCAATATTGCCAGTGTTGCTGCCCA
TTTATACTACTGTCTCAACCATATTGAGGACGGTATCGAAGATCTGGAACGGTTTACCTACTGCTACGACGATAGTTACCTCACTACAGG
ACGAGAATTGTTCCGCATCTCCAAAAAATTACGAAATGAAGCTCAAGATGCAATCAAAGCCGTGTTTTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine20129 %
Guanine14121 %
Thyamine16724 %
Cytosine19028 %
A+T36853 %
G+C33148 %

Total Bases :   699 bases

Microsatellites
SequencePosition LengthRepeats
ACACAC33723
AAAAAA65123

Microsatellite Map

ATGTCTGGTCATAATCACTACCAAACCCTAGAAGTCGATCCAGCTGCAACGCCAGCTGAGATCAAATCTGCCTATCGGCGTCTGGCTAAG
TTATTTCACCCCGATAGCCATCATCAGATGGCGAATCATGAGCGCATTGCTCAGGTGAATGAAGCTTACGAAGTTTTAAAAGATCCCCAT
CGACGGTTGGCCTATGACCAACATCGCCGTACGGCTCCCACCAAAGGTTCATGGGGAAATGCACAGGCTGGCGCTACCCGCAGTCAAGCC
TACCAAAAACCAACCCAAACTGCCCGCACAACAGAGATCCATCTCCAGCAATGGTTAAAGCAGGTGTACACACCTGTCAATCGGCACCTG
GCTAATATTCTTAACCCCCTAGCCGATGAAATCCAATGTTTATCTGCCGATCCCTATGACGATGATTTAATGGCAGATTTTCAGGATTAC
TTAGCCGATTGCCGGACTTGCCTAGAAAAGGCTCAAACGATCTTCCAATCTTTCCCGAATCCCGGCAATATTGCCAGTGTTGCTGCCCAT
TTATACTACTGTCTCAACCATATTGAGGACGGTATCGAAGATCTGGAACGGTTTACCTACTGCTACGACGATAGTTACCTCACTACAGGA
CGAGAATTGTTCCGCATCTCCAAAAAATTACGAAATGAAGCTCAAGATGCAATCAAAGCCGTGTTTTAG

Gene Information
Molecule Type genomic DNA
Bases 699 Bases
Molecular Weight215057.46 Da
Coding Sequence CP000828.1:806088..806786
NCBI ReferenceABW25869
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 5 to 66 62 N-terminal DnaJ domain PF00226

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA5

Accession Number

HSP40_0005

Added on

2012-02-02

Updated On

2014-01-20