Help  Custom Search
 
DnaJ-like protein, putative of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ-like protein, putative

Synonymous Names

B0CBA1_ACAM1, Hsp40/J-protein

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MVDSQDHYSVLQVSPQATPADIKTAFRRLVRQYHPDLNPNNPRAAEAFQKICTAYEVLSNRDRRVIYDHN DGPRSPFVEEPGSVVLQDAQQYFMQGVQKANRRNYATAIADFTQAIHLDKNYLEAYMGRCQARFALGHNR EVLQDCDHILSIQPQSAQAFFFRGRSCYRLGHLDLSIESYSQAIALEKDYAQAFYHRGIAYIKVKERLAI RDLQAAASLFRQQGHIGHYQRAIATLKDLNRKPANILLNLPRNGATLATTALTTLPRLLVNPSGAALQVW QSQLPYQSIGISLICAGLAMGCVVGGAHLFAPKPWTVSDSQVMLLSLVAFSSLVLAGSLIRRMVGKGGSW SGDLLVAGSAMLPVGVWAFLSGLAMQLGQIELIALSLFASSFTILGLYSGYTKIGQIAEPIAALAVPTIV MISYGVTALLYRALMLQLV

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGTGGACTCACAAGATCATTACAGTGTGCTGCAGGTGTCTCCACAGGCGACTCCAGCAGATATCAAAACGGCTTTTCGTCGACTGGT
TCGACAGTATCATCCCGACTTAAACCCCAATAACCCTAGAGCTGCAGAGGCTTTTCAAAAAATATGTACAGCCTATGAAGTTCTGAGTAA
TCGTGATCGGCGAGTTATTTATGATCATAACGATGGCCCTCGATCTCCGTTTGTAGAAGAACCCGGTTCTGTTGTTCTCCAAGATGCTCA
ACAATATTTTATGCAAGGGGTACAAAAGGCAAATAGACGAAATTATGCCACTGCGATTGCTGATTTTACCCAGGCGATTCACCTCGACAA
GAATTATTTAGAAGCCTATATGGGGCGATGTCAAGCTCGGTTTGCCCTCGGCCATAATCGGGAAGTTTTGCAAGATTGTGATCATATTTT
GAGCATTCAGCCCCAATCAGCTCAAGCCTTCTTTTTTCGGGGACGATCTTGCTATCGGTTAGGTCATTTAGATCTATCTATTGAATCCTA
TTCCCAAGCTATTGCCCTCGAAAAAGACTATGCTCAAGCGTTTTATCATCGAGGTATTGCTTATATCAAGGTGAAAGAGCGCTTGGCGAT
TCGTGATTTGCAAGCGGCTGCGAGTTTGTTCCGACAACAGGGACATATTGGTCATTACCAACGGGCCATCGCAACCCTCAAGGATCTTAA
TCGCAAGCCCGCCAATATCCTCTTGAATCTGCCTCGAAATGGGGCAACTTTGGCAACTACTGCTTTGACGACCTTACCTCGCCTGCTGGT
TAATCCCAGTGGTGCTGCCTTACAGGTTTGGCAAAGTCAGCTGCCATATCAATCCATCGGTATAAGCTTGATTTGTGCAGGTCTGGCCAT
GGGTTGCGTGGTGGGGGGTGCCCATCTCTTTGCGCCCAAGCCCTGGACCGTTTCGGATTCTCAAGTGATGCTGCTCAGCTTGGTGGCTTT
TTCTAGTTTAGTGTTGGCAGGTAGTCTGATTCGGCGGATGGTAGGGAAAGGAGGGAGCTGGTCTGGAGATTTGCTGGTAGCTGGGTCGGC
AATGCTGCCCGTGGGCGTCTGGGCGTTTTTAAGTGGCCTAGCGATGCAGCTCGGCCAAATTGAGCTGATTGCCCTAAGTCTGTTTGCCTC
CAGCTTTACCATACTTGGCTTATATAGTGGCTACACCAAGATTGGTCAAATTGCGGAACCCATTGCAGCCCTGGCAGTCCCCACAATTGT
GATGATTAGCTATGGCGTGACTGCCTTGCTGTATCGAGCGTTGATGCTGCAATTGGTCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine30424 %
Guanine33226 %
Thyamine37829 %
Cytosine30624 %
A+T68252 %
G+C63849 %

Total Bases :   1320 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA14523
TTTTTT48023
GGGGGG91123
TATATA118923

Microsatellite Map

ATGGTGGACTCACAAGATCATTACAGTGTGCTGCAGGTGTCTCCACAGGCGACTCCAGCAGATATCAAAACGGCTTTTCGTCGACTGGTT
CGACAGTATCATCCCGACTTAAACCCCAATAACCCTAGAGCTGCAGAGGCTTTTCAAAAAATATGTACAGCCTATGAAGTTCTGAGTAAT
CGTGATCGGCGAGTTATTTATGATCATAACGATGGCCCTCGATCTCCGTTTGTAGAAGAACCCGGTTCTGTTGTTCTCCAAGATGCTCAA
CAATATTTTATGCAAGGGGTACAAAAGGCAAATAGACGAAATTATGCCACTGCGATTGCTGATTTTACCCAGGCGATTCACCTCGACAAG
AATTATTTAGAAGCCTATATGGGGCGATGTCAAGCTCGGTTTGCCCTCGGCCATAATCGGGAAGTTTTGCAAGATTGTGATCATATTTTG
AGCATTCAGCCCCAATCAGCTCAAGCCTTCTTTTTTCGGGGACGATCTTGCTATCGGTTAGGTCATTTAGATCTATCTATTGAATCCTAT
TCCCAAGCTATTGCCCTCGAAAAAGACTATGCTCAAGCGTTTTATCATCGAGGTATTGCTTATATCAAGGTGAAAGAGCGCTTGGCGATT
CGTGATTTGCAAGCGGCTGCGAGTTTGTTCCGACAACAGGGACATATTGGTCATTACCAACGGGCCATCGCAACCCTCAAGGATCTTAAT
CGCAAGCCCGCCAATATCCTCTTGAATCTGCCTCGAAATGGGGCAACTTTGGCAACTACTGCTTTGACGACCTTACCTCGCCTGCTGGTT
AATCCCAGTGGTGCTGCCTTACAGGTTTGGCAAAGTCAGCTGCCATATCAATCCATCGGTATAAGCTTGATTTGTGCAGGTCTGGCCATG
GGTTGCGTGGTGGGGGGTGCCCATCTCTTTGCGCCCAAGCCCTGGACCGTTTCGGATTCTCAAGTGATGCTGCTCAGCTTGGTGGCTTTT
TCTAGTTTAGTGTTGGCAGGTAGTCTGATTCGGCGGATGGTAGGGAAAGGAGGGAGCTGGTCTGGAGATTTGCTGGTAGCTGGGTCGGCA
ATGCTGCCCGTGGGCGTCTGGGCGTTTTTAAGTGGCCTAGCGATGCAGCTCGGCCAAATTGAGCTGATTGCCCTAAGTCTGTTTGCCTCC
AGCTTTACCATACTTGGCTTATATAGTGGCTACACCAAGATTGGTCAAATTGCGGAACCCATTGCAGCCCTGGCAGTCCCCACAATTGTG
ATGATTAGCTATGGCGTGACTGCCTTGCTGTATCGAGCGTTGATGCTGCAATTGGTCTAA

Gene Information
Molecule Type genomic DNA
Bases 1320 Bases
Molecular Weight407928.28 Da
Coding Sequence complement(CP000828.1:1703608..1704927)
NCBI ReferenceABW26740
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 6 to 68 63 N-terminal DnaJ domain PF00226
TPR 89 to 122 34 Tetratricopeptide repeat PF00515
TPR 157 to 190 34 Tetratricopeptide repeat PF00515
TMhelix 289 to 311 23 Transmembrane helix region Manually identified
TMhelix 321 to 340 20 Transmembrane helix region Manually identified
TMhelix 347 to 369 23 Transmembrane helix region Manually identified
TMhelix 379 to 401 23 Transmembrane helix region Manually identified
TMhelix 413 to 435 23 Transmembrane helix region Manually identified

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA4

Accession Number

HSP40_0004

Added on

2012-02-02

Updated On

2014-01-20