Help  Custom Search
 
DnaJ-like protein of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

DnaJ-like protein

Synonymous Names

B0CG87_ACAM1, Hsp40/J-protein

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type III J-Protein

SEQUENCE INFORMATION

Sequence
MQNFRNYYDILKVSKEASTEEIKRSYRKLARQYHPDLNPGDKAAEEQFKTISEAYDVLSDVEKRSKYDQF GQYWQQQGFQKSSSPQSTKKWGGQTNPFVSDKVDFSEFADFQEFLDQLLERPYGKKSNARKQTRKKPKSS SVGQRDAEARLTLPLEKAYAGGRERIRLEDGRSLEVSMPMGMVSGQRIRLKGQGTSGGDLYLKIDVSPHA FYRLEGNDIICELPITCAEAILGGQIEAPTLDGWVKVTIPSGVRSGQRLRLGGKGYPASNGKRGDQLVEI RIESPKNISPRERELYEQIRQIETYKPRANLPIM

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCAGAACTTCCGCAATTACTACGACATTCTTAAGGTGTCTAAAGAGGCATCCACGGAAGAGATTAAGCGTTCCTATCGAAAATTAGC
CCGGCAATATCATCCCGATTTGAACCCGGGCGATAAAGCGGCGGAAGAGCAGTTCAAAACCATCAGTGAAGCCTACGATGTCTTGTCGGA
TGTCGAAAAGCGTTCTAAGTACGATCAGTTTGGCCAATATTGGCAGCAACAAGGATTTCAAAAATCGAGCAGTCCCCAATCCACGAAGAA
ATGGGGGGGACAAACCAATCCCTTTGTCTCTGATAAGGTGGATTTTAGTGAATTTGCAGATTTCCAAGAGTTTTTAGATCAGCTCTTAGA
GCGGCCCTATGGCAAGAAGAGCAATGCTCGTAAGCAAACGAGGAAGAAGCCGAAATCGTCCTCGGTGGGTCAGCGAGATGCCGAAGCTCG
CCTGACTCTGCCCTTGGAAAAGGCTTATGCCGGGGGCCGAGAGCGTATTCGCCTAGAAGATGGACGGTCCTTAGAAGTGTCGATGCCCAT
GGGGATGGTGTCGGGCCAGCGCATTCGTCTGAAGGGGCAGGGAACTTCCGGCGGTGACCTTTATCTCAAAATTGATGTTTCGCCCCATGC
CTTCTATCGCTTAGAAGGGAACGATATTATTTGCGAACTACCGATTACCTGTGCAGAAGCCATCCTGGGGGGACAAATCGAAGCCCCCAC
CTTAGACGGATGGGTGAAGGTGACCATTCCTAGTGGGGTTCGTTCTGGCCAGCGGCTACGGCTGGGGGGGAAAGGATACCCGGCTTCAAA
TGGAAAGCGAGGCGATCAATTAGTTGAGATTCGCATTGAATCGCCTAAAAATATTAGTCCTAGAGAGCGGGAACTCTACGAACAAATCCG
CCAAATTGAAACCTATAAACCACGGGCAAATTTACCGATTATGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine26529 %
Guanine25527 %
Thyamine21223 %
Cytosine21323 %
A+T47751 %
G+C46850 %

Total Bases :   945 bases

Microsatellites
SequencePosition LengthRepeats
GGGGGG27123
GGGGGG69523
GGGGGG78223
AGAGAG87023

Microsatellite Map

ATGCAGAACTTCCGCAATTACTACGACATTCTTAAGGTGTCTAAAGAGGCATCCACGGAAGAGATTAAGCGTTCCTATCGAAAATTAGCC
CGGCAATATCATCCCGATTTGAACCCGGGCGATAAAGCGGCGGAAGAGCAGTTCAAAACCATCAGTGAAGCCTACGATGTCTTGTCGGAT
GTCGAAAAGCGTTCTAAGTACGATCAGTTTGGCCAATATTGGCAGCAACAAGGATTTCAAAAATCGAGCAGTCCCCAATCCACGAAGAAA
TGGGGGGGACAAACCAATCCCTTTGTCTCTGATAAGGTGGATTTTAGTGAATTTGCAGATTTCCAAGAGTTTTTAGATCAGCTCTTAGAG
CGGCCCTATGGCAAGAAGAGCAATGCTCGTAAGCAAACGAGGAAGAAGCCGAAATCGTCCTCGGTGGGTCAGCGAGATGCCGAAGCTCGC
CTGACTCTGCCCTTGGAAAAGGCTTATGCCGGGGGCCGAGAGCGTATTCGCCTAGAAGATGGACGGTCCTTAGAAGTGTCGATGCCCATG
GGGATGGTGTCGGGCCAGCGCATTCGTCTGAAGGGGCAGGGAACTTCCGGCGGTGACCTTTATCTCAAAATTGATGTTTCGCCCCATGCC
TTCTATCGCTTAGAAGGGAACGATATTATTTGCGAACTACCGATTACCTGTGCAGAAGCCATCCTGGGGGGACAAATCGAAGCCCCCACC
TTAGACGGATGGGTGAAGGTGACCATTCCTAGTGGGGTTCGTTCTGGCCAGCGGCTACGGCTGGGGGGGAAAGGATACCCGGCTTCAAAT
GGAAAGCGAGGCGATCAATTAGTTGAGATTCGCATTGAATCGCCTAAAAATATTAGTCCTAGAGAGCGGGAACTCTACGAACAAATCCGC
CAAATTGAAACCTATAAACCACGGGCAAATTTACCGATTATGTGA

Gene Information
Molecule Type genomic DNA
Bases 945 Bases
Molecular Weight292972.98 Da
Coding Sequence CP000828.1:5762184..5763128
NCBI ReferenceABW30640
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 6 to 68 63 N-terminal DnaJ domain PF00226
C-terminal domain 186 to 300 115 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA3

Accession Number

HSP40_0003

Added on

2012-02-02

Updated On

2014-01-20