Help  Custom Search
 
heat shock protein DnaJ of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein DnaJ

Synonymous Names

B0C1Y4_ACAM1, Hsp40/J-protein, Chaperone DnaJ family

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type II J-Protein

SEQUENCE INFORMATION

Sequence
MPAADYKDYYQILGVSKSSSEAEIKRVFRKLARKYHPDMNPGDKTAEAKFKEISEAYEVLSDPDKRRKYD QFGQYWNQAGGQGSGFDFDFGQYGSFDDFINELLGRFSGGFGAGNASTRSQSTSYRGGASSTPGFGGFQD FAGFNTPGISADAEADLKLTFSEALKGVEKRLTIGGTETITVRIPPGAKPDNRIRVKGKGQVNPLNQSRG DLYLKVKLDAHPFFKFDKENILCTLPIAPDEAALGAKVDIPTPTGEVSMNIPAGIKSGQSLRLRGKGWPS AKGSASDLVVKIQIVPPPDLSTTEKELYEKLANLRQYDPRSNLLEKSP

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCCTGCTGCGGATTACAAAGACTACTACCAAATTCTTGGGGTGAGTAAGTCCTCTAGTGAAGCAGAAATAAAGCGGGTTTTTCGTAA
GCTAGCTCGGAAGTACCACCCAGATATGAATCCGGGGGATAAAACTGCCGAGGCCAAATTCAAAGAAATCAGCGAAGCCTACGAGGTACT
ATCGGATCCAGATAAACGGCGCAAATATGATCAGTTTGGCCAATATTGGAATCAAGCTGGTGGACAAGGGAGTGGCTTCGATTTTGATTT
TGGGCAATATGGCAGTTTTGACGACTTTATCAATGAACTATTAGGGCGATTTTCCGGTGGGTTTGGAGCGGGAAACGCCTCGACCAGATC
CCAAAGCACTTCCTACCGCGGAGGAGCATCTAGCACCCCAGGGTTTGGCGGGTTCCAAGATTTTGCAGGCTTCAACACACCCGGTATTTC
TGCAGATGCCGAAGCAGACTTAAAATTGACCTTTTCAGAAGCCCTCAAAGGCGTAGAAAAACGACTGACCATCGGCGGCACTGAGACCAT
CACCGTCCGGATTCCCCCCGGTGCCAAACCTGATAACCGCATACGAGTTAAAGGGAAAGGACAAGTGAACCCCCTCAATCAATCCAGAGG
GGATCTTTACCTCAAAGTCAAACTAGACGCCCACCCCTTTTTTAAGTTTGACAAGGAAAATATTTTATGTACCCTCCCCATTGCCCCAGA
TGAAGCGGCCTTAGGCGCCAAGGTTGATATTCCAACCCCGACCGGGGAAGTCAGTATGAATATCCCTGCCGGTATTAAATCCGGACAATC
CTTACGGCTTCGAGGAAAGGGATGGCCAAGCGCTAAGGGGAGTGCCAGCGATCTAGTGGTTAAGATTCAAATCGTCCCTCCCCCTGATCT
GAGCACCACCGAAAAGGAGTTATATGAGAAACTCGCAAACCTGCGGCAATATGATCCCCGCTCAAATCTGCTCGAAAAATCCCCTTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine28429 %
Guanine23825 %
Thyamine21823 %
Cytosine24726 %
A+T50251 %
G+C48550 %

Total Bases :   987 bases

Microsatellites
SequencePosition LengthRepeats
ACACAC43323
CCCCCC55223
TTTTTT66623

Microsatellite Map

ATGCCTGCTGCGGATTACAAAGACTACTACCAAATTCTTGGGGTGAGTAAGTCCTCTAGTGAAGCAGAAATAAAGCGGGTTTTTCGTAAG
CTAGCTCGGAAGTACCACCCAGATATGAATCCGGGGGATAAAACTGCCGAGGCCAAATTCAAAGAAATCAGCGAAGCCTACGAGGTACTA
TCGGATCCAGATAAACGGCGCAAATATGATCAGTTTGGCCAATATTGGAATCAAGCTGGTGGACAAGGGAGTGGCTTCGATTTTGATTTT
GGGCAATATGGCAGTTTTGACGACTTTATCAATGAACTATTAGGGCGATTTTCCGGTGGGTTTGGAGCGGGAAACGCCTCGACCAGATCC
CAAAGCACTTCCTACCGCGGAGGAGCATCTAGCACCCCAGGGTTTGGCGGGTTCCAAGATTTTGCAGGCTTCAACACACCCGGTATTTCT
GCAGATGCCGAAGCAGACTTAAAATTGACCTTTTCAGAAGCCCTCAAAGGCGTAGAAAAACGACTGACCATCGGCGGCACTGAGACCATC
ACCGTCCGGATTCCCCCCGGTGCCAAACCTGATAACCGCATACGAGTTAAAGGGAAAGGACAAGTGAACCCCCTCAATCAATCCAGAGGG
GATCTTTACCTCAAAGTCAAACTAGACGCCCACCCCTTTTTTAAGTTTGACAAGGAAAATATTTTATGTACCCTCCCCATTGCCCCAGAT
GAAGCGGCCTTAGGCGCCAAGGTTGATATTCCAACCCCGACCGGGGAAGTCAGTATGAATATCCCTGCCGGTATTAAATCCGGACAATCC
TTACGGCTTCGAGGAAAGGGATGGCCAAGCGCTAAGGGGAGTGCCAGCGATCTAGTGGTTAAGATTCAAATCGTCCCTCCCCCTGATCTG
AGCACCACCGAAAAGGAGTTATATGAGAAACTCGCAAACCTGCGGCAATATGATCCCCGCTCAAATCTGCTCGAAAAATCCCCTTAG

Gene Information
Molecule Type genomic DNA
Bases 987 Bases
Molecular Weight304984.72 Da
Coding Sequence CP000828.1:1089496..1090482
NCBI ReferenceABW26150
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 8 to 70 63 N-terminal DnaJ domain PF00226
G/F-rich region 80 to 138 59 Glycine-phenylalanine rich region Manually identified
C-terminal domain 192 to 312 121 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA2

Accession Number

HSP40_0002

Added on

2012-02-02

Updated On

2014-01-20