Help  Custom Search
 
Chaperone protein DnaJ of Acaryochloris marina str. MBIC 11017

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

Chaperone protein DnaJ

Synonymous Names

DNAJ_ACAM1, Hsp40/J-protein, DnaJ

Gene names

Gene Name

dnaJ

Gene Locus Tag

AM1_0423

Gene Identifier

5679254

Taxon Information

Organism

Acaryochloris marina str. MBIC 11017

Organism ID

329726 [NCBI] [UNIPROT]

Lineage

Bacteria; Cyanobacteria; Acaryochloris marina MBIC11017

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp40 Protein family

Protein Type

Type I J-Protein

SEQUENCE INFORMATION

Sequence
MARDYYDILGVSRSADPDELKRSYRRLARKYHPDVNKEPGAEDKFKEINKAYETLSDPQMRGRYDQFGEA GVSSAAGAGYQDFGDFGGFADIFETFFSGFGGSPQSGRRRSGPARGEDLRFDLKLKFREAVFGGEQQIRI SHLESCKTCEGTGAKPGTRPQTCSTCQGSGQVRRMTRTPLGNFTQVSVCPTCNGQGQVVTEKCDSCGGRG QNQVSKKLQIKIPAGVDTGTRLRVSNEGDAGQKGGPPGDLYVYLFVQEDSEFRRDGTNVLSEFKISYLQA ILGAQLPVKTVDGEETITIPAGTQPGTVLTLENHGVPRLGNPVSRGDHLITVIIDIPNRISTEERELLVQ LASIRAEQTGKGGIEGFLGGIFGR

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCCCGCGACTACTACGACATTCTAGGTGTTTCCCGCAGCGCCGACCCCGATGAGCTCAAGCGTTCCTATCGACGTTTAGCCCGTAA
GTACCATCCCGATGTCAATAAAGAACCAGGGGCCGAAGATAAATTTAAAGAAATCAATAAAGCCTACGAAACCTTGTCCGATCCGCAAAT
GCGAGGCCGGTATGACCAGTTTGGTGAAGCAGGGGTCAGCTCAGCCGCAGGGGCAGGCTATCAAGACTTTGGCGACTTCGGTGGATTTGC
AGATATCTTTGAAACCTTTTTTAGTGGTTTTGGAGGGAGTCCACAATCAGGAAGACGTCGTTCGGGTCCAGCACGGGGCGAGGATCTGCG
ATTTGATCTCAAGCTCAAGTTTAGAGAAGCCGTGTTTGGTGGAGAACAGCAAATTCGCATTTCTCACCTAGAAAGCTGTAAAACTTGTGA
AGGAACTGGGGCAAAACCTGGCACTCGACCCCAAACCTGCAGTACTTGCCAAGGGTCGGGTCAAGTTCGGCGGATGACCCGTACGCCTCT
GGGAAATTTTACGCAAGTGTCTGTTTGTCCAACTTGCAACGGTCAAGGGCAAGTGGTAACAGAAAAGTGTGATAGCTGTGGTGGACGTGG
GCAAAACCAAGTCAGCAAGAAATTACAAATCAAAATTCCAGCTGGCGTAGATACAGGTACTCGATTGCGGGTCTCCAATGAAGGAGATGC
GGGCCAAAAAGGTGGGCCTCCTGGTGATTTGTATGTTTATCTGTTTGTACAAGAAGACTCAGAATTTCGTCGCGATGGCACCAATGTCCT
ATCTGAGTTTAAGATCAGCTACTTGCAGGCGATTTTAGGTGCCCAACTGCCGGTAAAAACCGTGGATGGAGAAGAGACCATTACGATTCC
TGCGGGAACTCAACCAGGCACTGTTTTAACCCTGGAAAATCACGGTGTTCCCCGTTTAGGTAATCCGGTAAGTCGGGGAGACCATTTGAT
TACGGTCATTATTGATATTCCTAACCGAATCTCCACAGAAGAGCGTGAGTTGTTGGTGCAGCTCGCCAGTATTCGAGCGGAGCAAACTGG
GAAAGGCGGAATCGAAGGCTTCCTCGGGGGCATTTTTGGCCGATGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine29927 %
Guanine30928 %
Thyamine26624 %
Cytosine25123 %
A+T56551 %
G+C56050 %

Total Bases :   1125 bases

Microsatellites
SequencePosition LengthRepeats
TTTTTT28523

Microsatellite Map

ATGGCCCGCGACTACTACGACATTCTAGGTGTTTCCCGCAGCGCCGACCCCGATGAGCTCAAGCGTTCCTATCGACGTTTAGCCCGTAAG
TACCATCCCGATGTCAATAAAGAACCAGGGGCCGAAGATAAATTTAAAGAAATCAATAAAGCCTACGAAACCTTGTCCGATCCGCAAATG
CGAGGCCGGTATGACCAGTTTGGTGAAGCAGGGGTCAGCTCAGCCGCAGGGGCAGGCTATCAAGACTTTGGCGACTTCGGTGGATTTGCA
GATATCTTTGAAACCTTTTTTAGTGGTTTTGGAGGGAGTCCACAATCAGGAAGACGTCGTTCGGGTCCAGCACGGGGCGAGGATCTGCGA
TTTGATCTCAAGCTCAAGTTTAGAGAAGCCGTGTTTGGTGGAGAACAGCAAATTCGCATTTCTCACCTAGAAAGCTGTAAAACTTGTGAA
GGAACTGGGGCAAAACCTGGCACTCGACCCCAAACCTGCAGTACTTGCCAAGGGTCGGGTCAAGTTCGGCGGATGACCCGTACGCCTCTG
GGAAATTTTACGCAAGTGTCTGTTTGTCCAACTTGCAACGGTCAAGGGCAAGTGGTAACAGAAAAGTGTGATAGCTGTGGTGGACGTGGG
CAAAACCAAGTCAGCAAGAAATTACAAATCAAAATTCCAGCTGGCGTAGATACAGGTACTCGATTGCGGGTCTCCAATGAAGGAGATGCG
GGCCAAAAAGGTGGGCCTCCTGGTGATTTGTATGTTTATCTGTTTGTACAAGAAGACTCAGAATTTCGTCGCGATGGCACCAATGTCCTA
TCTGAGTTTAAGATCAGCTACTTGCAGGCGATTTTAGGTGCCCAACTGCCGGTAAAAACCGTGGATGGAGAAGAGACCATTACGATTCCT
GCGGGAACTCAACCAGGCACTGTTTTAACCCTGGAAAATCACGGTGTTCCCCGTTTAGGTAATCCGGTAAGTCGGGGAGACCATTTGATT
ACGGTCATTATTGATATTCCTAACCGAATCTCCACAGAAGAGCGTGAGTTGTTGGTGCAGCTCGCCAGTATTCGAGCGGAGCAAACTGGG
AAAGGCGGAATCGAAGGCTTCCTCGGGGGCATTTTTGGCCGATGA

Gene Information
Molecule Type genomic DNA
Bases 1125 Bases
Molecular Weight348815.1 Da
Coding Sequence CP000828.1:398585..399709
NCBI ReferenceABW25480
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
J-domain 4 to 65 62 N-terminal DnaJ domain PF00226
G/F-rich region 77 to 102 26 Glycine-phenylalanine rich region Manually identified
Zinc-finger domain 133 to 217 85 Cysteine-Rich domain (CXXCXGXG) PF00684
C-terminal domain 230 to 352 123 DnaJ C terminal region PF01556

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HSP40_ACMA1

Accession Number

HSP40_0001

Added on

2012-02-02

Updated On

2014-01-20