Help  Custom Search
 
ATP-dependent protease ATP-binding subunit ClpX. of Helicobacter pylori str. 26695

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent protease ATP-binding subunit ClpX.

Synonymous Names

CLPX_HELPY, Caseinolytic peptidase X, ClpX.

Gene names

Gene Name

clpX

Gene Locus Tag

HP1374

Gene Identifier

900311

Taxon Information

Organism

Helicobacter pylori str. 26695

Organism ID

85962 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori 26695

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpX-Caseinolytic peptidase X)

SEQUENCE INFORMATION

Sequence
MNETLYCSFCKKPESRDPKKRRIIFASNLNKDVCVCEYCIDVMHGELHKYDNSLLALKRDRLRRMESSAY EEEFLLSYIPAPKELKAVLDNYVIGQEQAKKVFSVAVYNHYKRLSFKEKLKKQDNQDSNVELEHLEEVEL SKSNILLIGPTGSGKTLMAQTLAKHLDIPIAISDATSLTEAGYVGEDVENILTRLLQASDWNVQKAQKGI VFIDEIDKISRLSENRSITRDVSGEGVQQALLKIVEGSLVNIPPKGGRKHPEGNFIQIDTSDILFICAGA FDGLAEIIKKRTTQNVLGFTQEKMSKKEQEAILHLVQTHDLVTYGLIPELIGRLPVLSTLDSISLEAMVD ILQKPKNALIKQYQQLFKMDEVDLIFEEEAIKEIAQLALERKTGARGLRAIIEDFCLDIMFDLPKLKGSE VRITKDCVLKQAEPLIIAKTHSKILP

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAACGAAACGCTTTATTGCAGTTTTTGCAAAAAACCAGAATCAAGAGATCCCAAAAAACGCCGCATTATTTTTGCGAGCAATCTCAA
TAAAGATGTGTGCGTGTGCGAATATTGTATAGATGTGATGCATGGGGAATTGCACAAATACGACAATTCTTTATTGGCGCTCAAAAGAGA
CCGATTGAGAAGAATGGAATCTAGCGCTTATGAAGAAGAGTTTTTACTCTCTTACATTCCAGCCCCTAAAGAGCTTAAGGCGGTTTTAGA
CAATTATGTGATAGGGCAAGAGCAGGCTAAAAAGGTTTTTTCCGTAGCCGTGTATAACCATTACAAACGCTTATCTTTTAAAGAAAAACT
CAAAAAACAAGACAACCAAGACAGCAATGTGGAGTTAGAGCATTTAGAAGAAGTGGAGTTGAGCAAGTCTAATATTTTACTAATCGGCCC
TACAGGATCAGGCAAAACTTTAATGGCGCAAACTCTGGCCAAGCATTTGGATATTCCTATCGCCATTAGCGATGCGACTAGCTTGACTGA
AGCGGGCTATGTGGGCGAAGACGTGGAAAATATTCTCACAAGATTGTTGCAAGCGAGCGACTGGAATGTCCAAAAAGCCCAAAAAGGCAT
TGTGTTTATTGATGAGATTGATAAAATCAGCCGTTTGTCAGAAAACCGCTCTATCACTAGAGATGTTTCTGGCGAGGGCGTTCAGCAAGC
GTTGTTGAAAATCGTTGAAGGTTCTTTAGTGAATATCCCCCCCAAAGGCGGCAGAAAGCACCCTGAGGGCAATTTCATTCAAATTGACAC
GAGCGATATTTTATTCATTTGTGCTGGAGCGTTTGATGGGTTAGCTGAAATCATTAAAAAACGCACCACGCAGAATGTGTTGGGTTTCAC
TCAAGAAAAGATGAGCAAAAAAGAGCAAGAAGCGATCTTGCATTTAGTCCAAACCCATGACCTGGTTACTTATGGGCTTATCCCTGAGCT
TATTGGCCGTTTGCCGGTTTTAAGCACGCTAGATAGCATCAGTTTAGAAGCGATGGTGGATATTTTACAAAAACCTAAAAACGCTCTTAT
CAAGCAATACCAGCAGCTTTTCAAAATGGATGAGGTGGATTTGATCTTTGAAGAAGAAGCCATTAAAGAAATCGCTCAACTCGCATTAGA
AAGAAAAACCGGGGCTAGGGGCTTAAGGGCGATCATTGAAGATTTTTGTTTGGATATTATGTTTGATTTACCCAAGCTTAAAGGATCGGA
AGTGCGTATCACTAAAGATTGTGTTTTAAAACAGGCTGAACCTTTGATCATTGCTAAAACGCATTCTAAAATTCTTCCTTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine43533 %
Guanine30123 %
Thyamine36328 %
Cytosine24219 %
A+T79860 %
G+C54341 %

Total Bases :   1341 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA3023
AAAAAA5423
TGTGTG9523
CTCTCT22523
TTTTTT30423
AAAAAA36023
CCCCCC75523
AAAAAA86423
AAAAAA91523
GAAGAAGAA112833

Microsatellite Map

ATGAACGAAACGCTTTATTGCAGTTTTTGCAAAAAACCAGAATCAAGAGATCCCAAAAAACGCCGCATTATTTTTGCGAGCAATCTCAAT
AAAGATGTGTGCGTGTGCGAATATTGTATAGATGTGATGCATGGGGAATTGCACAAATACGACAATTCTTTATTGGCGCTCAAAAGAGAC
CGATTGAGAAGAATGGAATCTAGCGCTTATGAAGAAGAGTTTTTACTCTCTTACATTCCAGCCCCTAAAGAGCTTAAGGCGGTTTTAGAC
AATTATGTGATAGGGCAAGAGCAGGCTAAAAAGGTTTTTTCCGTAGCCGTGTATAACCATTACAAACGCTTATCTTTTAAAGAAAAACTC
AAAAAACAAGACAACCAAGACAGCAATGTGGAGTTAGAGCATTTAGAAGAAGTGGAGTTGAGCAAGTCTAATATTTTACTAATCGGCCCT
ACAGGATCAGGCAAAACTTTAATGGCGCAAACTCTGGCCAAGCATTTGGATATTCCTATCGCCATTAGCGATGCGACTAGCTTGACTGAA
GCGGGCTATGTGGGCGAAGACGTGGAAAATATTCTCACAAGATTGTTGCAAGCGAGCGACTGGAATGTCCAAAAAGCCCAAAAAGGCATT
GTGTTTATTGATGAGATTGATAAAATCAGCCGTTTGTCAGAAAACCGCTCTATCACTAGAGATGTTTCTGGCGAGGGCGTTCAGCAAGCG
TTGTTGAAAATCGTTGAAGGTTCTTTAGTGAATATCCCCCCCAAAGGCGGCAGAAAGCACCCTGAGGGCAATTTCATTCAAATTGACACG
AGCGATATTTTATTCATTTGTGCTGGAGCGTTTGATGGGTTAGCTGAAATCATTAAAAAACGCACCACGCAGAATGTGTTGGGTTTCACT
CAAGAAAAGATGAGCAAAAAAGAGCAAGAAGCGATCTTGCATTTAGTCCAAACCCATGACCTGGTTACTTATGGGCTTATCCCTGAGCTT
ATTGGCCGTTTGCCGGTTTTAAGCACGCTAGATAGCATCAGTTTAGAAGCGATGGTGGATATTTTACAAAAACCTAAAAACGCTCTTATC
AAGCAATACCAGCAGCTTTTCAAAATGGATGAGGTGGATTTGATCTTTGAAGAAGAAGCCATTAAAGAAATCGCTCAACTCGCATTAGAA
AGAAAAACCGGGGCTAGGGGCTTAAGGGCGATCATTGAAGATTTTTGTTTGGATATTATGTTTGATTTACCCAAGCTTAAAGGATCGGAA
GTGCGTATCACTAAAGATTGTGTTTTAAAACAGGCTGAACCTTTGATCATTGCTAAAACGCATTCTAAAATTCTTCCTTAA

Gene Information
Molecule Type genomic DNA
Bases 1341 Bases
Molecular Weight415682.76 Da
Coding Sequence complement(AE000511.1:1438087..1439427)
NCBI ReferenceAAD08417
Notessimilar to GB:L18867 SP:P33138 GB:Z23278 PID:347729

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Zf_C4 4 to 50 47 C4_type Zinc finger domain PF06689
NBD_2 140 to 337 198 Nucleotide binding domain 2 PF07724
Clp_C 343 to 432 90 C terminal, D2 small domain PF10431

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

1UM8 Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpX_HEPY1

Accession Number

HSP100_0286

Added on

2012-02-02

Updated On

2014-01-20