Help  Custom Search
 
ATP-dependent Clp protease. of Clostridium difficile str. 630

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent Clp protease.

Synonymous Names

Q18CA9_CLOD6, Caseinolytic peptidase C, ClpC.

Gene names

Gene Name

clpC

Gene Locus Tag

CD0026

Gene Identifier

4916495

Taxon Information

Organism

Clostridium difficile str. 630

Organism ID

272563 [NCBI] [UNIPROT]

Lineage

Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium difficile 630

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpC-Caseinolytic peptidase C)

SEQUENCE INFORMATION

Sequence
MNFNRFTQRAKKAIDLAFESAKSLGHNIVGSEHILLGLLREEEGIAAKVLSKVGFTEAYLEGKIVDMEGK GEEISEDIVLSPRSKQILELSGMFANKLKTNYIGTEHILLAIIQEGEGIANKILNYAGVNDRTLAQLTID MMGISDKNQYKAENSYTGNQNQAESKVLDKYGRNLTLYAKQNKIDPVIGREKEIQRVIQILSRRTKNNPV LIGDPGVGKTAIAEGLATNIALGNVPETLKNKTLYSLEMGSLLAGAKYRGEFEERIKEVVDEVVKNGNII LFIDEMHTIIGAGSTGEGSIDASNILKPALARGEIQVIGATTIDEYRKHVEKDSALERRFQPVMVDEPTK EDSIKILEGLRDKYEAHHKVKITDDAIKAAVELSTRYISDRYLPDKAIDLIDEAASKVRLKENTPPSEIK KLELEIENIDKEKEEAVRCQDFEKAAKIRDEQGLLKKQLEDVRERWNKSSKHSDLVDGEVIAEVVGLWTG IPVNKILEEEADRLLRLEEILHNRVIGQEQAVKSISKAIRRSRAGLKDPNRPIGSFLFLGPTGVGKTELS KALAEVQFGDENQIIRIDMSEYMEKHAVSRMIGSPPGYVGHDEGGQLTEKVRRNPYSVILFDEIEKAHPD VFNILLQILDDGRLTDSKGRTVDFKNTIVIMTSNVGASTIGRQKTLGFSIAKGDEEEKSQYEKMKENIMG ELKQRFRPEFLNRIDDIIVFHSLNENHISKIVLLMAAKLQERLKEMDIKLEMSDEAVKLISKSGFDLEYG ARPLKRALQKELEDELSEAILKGNVKKGSNVVAKVKDEKIVFETK

FASTA Format Composition Secondary Structure

Nucleotide
 GTGAACTTCAATAGATTTACACAAAGAGCTAAAAAGGCAATTGATTTAGCGTTTGAATCTGCTAAAAGTCTAGGACACAATATTGTCGG
AAGTGAACATATACTTTTAGGTCTTTTAAGAGAAGAAGAAGGTATAGCTGCTAAAGTTCTAAGTAAAGTTGGATTTACAGAAGCTTATTT
AGAAGGCAAAATAGTTGATATGGAAGGTAAGGGAGAAGAAATCTCAGAAGATATAGTATTAAGTCCAAGAAGTAAACAAATACTTGAATT
ATCAGGAATGTTTGCAAATAAATTAAAAACAAATTATATTGGGACTGAGCATATATTATTAGCAATTATTCAAGAAGGTGAAGGAATAGC
TAATAAGATTTTAAATTATGCTGGAGTAAATGATAGGACTTTAGCCCAATTAACAATTGATATGATGGGTATTAGTGATAAAAATCAATA
CAAAGCAGAAAATAGTTACACGGGCAACCAGAATCAAGCAGAATCTAAAGTACTTGATAAGTATGGAAGAAATCTTACACTATATGCAAA
ACAGAATAAAATAGACCCTGTAATAGGTAGAGAAAAAGAAATACAAAGAGTAATACAAATATTAAGTAGAAGAACTAAAAACAATCCAGT
GTTGATAGGAGACCCAGGTGTAGGGAAAACAGCCATAGCTGAAGGTCTGGCTACAAATATAGCCTTAGGAAATGTTCCAGAAACACTAAA
AAACAAAACTTTATACTCTTTAGAGATGGGTTCATTATTGGCTGGAGCTAAGTATAGAGGAGAATTTGAAGAAAGAATTAAAGAAGTTGT
AGATGAAGTTGTTAAAAATGGAAACATAATCTTATTTATAGATGAGATGCACACAATAATAGGGGCTGGGTCTACTGGAGAAGGCTCTAT
AGATGCTTCAAATATATTAAAGCCAGCCTTAGCAAGAGGAGAAATACAAGTTATAGGTGCAACTACAATTGATGAATATAGAAAGCATGT
TGAAAAAGATTCTGCTCTAGAAAGAAGATTCCAACCAGTTATGGTAGATGAACCAACTAAAGAGGACTCAATAAAAATATTAGAAGGATT
AAGAGATAAATATGAAGCTCATCATAAAGTTAAAATAACTGATGATGCTATAAAGGCAGCTGTAGAATTATCAACTAGATATATATCAGA
CAGATATCTGCCAGATAAAGCTATAGACTTGATTGATGAAGCTGCATCAAAAGTAAGATTAAAAGAAAATACACCTCCTTCAGAAATAAA
AAAATTAGAACTAGAAATAGAAAATATAGATAAAGAAAAAGAAGAAGCAGTAAGATGTCAAGACTTTGAGAAAGCAGCCAAAATAAGAGA
TGAACAAGGTCTACTTAAAAAACAATTAGAAGATGTTAGAGAAAGATGGAACAAGTCATCTAAACATTCAGATTTAGTTGATGGAGAAGT
TATTGCTGAAGTAGTGGGCTTATGGACAGGAATACCAGTTAATAAAATTCTTGAAGAAGAGGCTGATAGACTTTTGAGACTTGAGGAAAT
ACTGCACAATAGAGTTATAGGTCAAGAACAAGCAGTAAAATCTATTTCAAAGGCAATCAGAAGGTCAAGAGCAGGTCTTAAAGACCCTAA
TAGACCAATTGGTTCATTTTTATTTTTAGGTCCAACAGGAGTAGGTAAAACAGAATTATCTAAGGCATTAGCAGAAGTGCAATTTGGAGA
TGAAAATCAAATAATTAGAATAGATATGTCTGAATATATGGAAAAACATGCTGTGTCAAGAATGATAGGTTCACCTCCAGGTTATGTAGG
TCATGATGAAGGTGGTCAATTAACTGAAAAAGTAAGAAGAAATCCATATTCAGTTATCTTATTTGATGAGATAGAAAAAGCTCATCCAGA
TGTATTTAATATTCTGTTACAAATTCTAGATGATGGTAGACTAACTGATTCAAAAGGAAGAACTGTAGATTTTAAGAATACTATTGTAAT
AATGACATCAAATGTTGGAGCATCTACAATTGGTAGACAAAAAACTTTAGGATTTAGTATAGCTAAAGGAGACGAAGAAGAAAAATCTCA
ATATGAAAAAATGAAAGAAAATATAATGGGTGAATTAAAACAAAGATTCAGACCAGAGTTTTTAAACAGAATAGATGATATAATTGTTTT
CCACTCACTAAATGAAAATCATATATCAAAAATAGTACTTTTAATGGCAGCGAAACTACAAGAGAGATTAAAAGAAATGGATATAAAATT
AGAAATGAGTGATGAGGCTGTTAAATTAATTTCTAAATCTGGATTTGACTTAGAATATGGAGCAAGACCTCTTAAAAGAGCTTTACAAAA
AGAGTTGGAAGATGAGCTATCTGAAGCAATCTTAAAAGGTAATGTGAAAAAGGGAAGTAATGTAGTAGCAAAAGTCAAAGATGAAAAAAT
AGTTTTTGAAACTAAATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine104543 %
Guanine48920 %
Thyamine63827 %
Cytosine27612 %
A+T168369 %
G+C76532 %

Total Bases :   2448 bases

Microsatellites
SequencePosition LengthRepeats
AGAAGAAGA11933
ATATAT31923
AAAAAA71623
CACACA85823
ATATAT91023
ATATATAT115724
AAAAAA125623
AAGAAGAAG129733
AAAAAA136523
ATATAT174223
AAAAAA201723
GAAGAAGAA205233
AAAAAA207423
ATATAT217923
AGAGAG221923
AAAAAA242223

Microsatellite Map

GTGAACTTCAATAGATTTACACAAAGAGCTAAAAAGGCAATTGATTTAGCGTTTGAATCTGCTAAAAGTCTAGGACACAATATTGTCGGA
AGTGAACATATACTTTTAGGTCTTTTAAGAGAAGAAGAAGGTATAGCTGCTAAAGTTCTAAGTAAAGTTGGATTTACAGAAGCTTATTTA
GAAGGCAAAATAGTTGATATGGAAGGTAAGGGAGAAGAAATCTCAGAAGATATAGTATTAAGTCCAAGAAGTAAACAAATACTTGAATTA
TCAGGAATGTTTGCAAATAAATTAAAAACAAATTATATTGGGACTGAGCATATATTATTAGCAATTATTCAAGAAGGTGAAGGAATAGCT
AATAAGATTTTAAATTATGCTGGAGTAAATGATAGGACTTTAGCCCAATTAACAATTGATATGATGGGTATTAGTGATAAAAATCAATAC
AAAGCAGAAAATAGTTACACGGGCAACCAGAATCAAGCAGAATCTAAAGTACTTGATAAGTATGGAAGAAATCTTACACTATATGCAAAA
CAGAATAAAATAGACCCTGTAATAGGTAGAGAAAAAGAAATACAAAGAGTAATACAAATATTAAGTAGAAGAACTAAAAACAATCCAGTG
TTGATAGGAGACCCAGGTGTAGGGAAAACAGCCATAGCTGAAGGTCTGGCTACAAATATAGCCTTAGGAAATGTTCCAGAAACACTAAAA
AACAAAACTTTATACTCTTTAGAGATGGGTTCATTATTGGCTGGAGCTAAGTATAGAGGAGAATTTGAAGAAAGAATTAAAGAAGTTGTA
GATGAAGTTGTTAAAAATGGAAACATAATCTTATTTATAGATGAGATGCACACAATAATAGGGGCTGGGTCTACTGGAGAAGGCTCTATA
GATGCTTCAAATATATTAAAGCCAGCCTTAGCAAGAGGAGAAATACAAGTTATAGGTGCAACTACAATTGATGAATATAGAAAGCATGTT
GAAAAAGATTCTGCTCTAGAAAGAAGATTCCAACCAGTTATGGTAGATGAACCAACTAAAGAGGACTCAATAAAAATATTAGAAGGATTA
AGAGATAAATATGAAGCTCATCATAAAGTTAAAATAACTGATGATGCTATAAAGGCAGCTGTAGAATTATCAACTAGATATATATCAGAC
AGATATCTGCCAGATAAAGCTATAGACTTGATTGATGAAGCTGCATCAAAAGTAAGATTAAAAGAAAATACACCTCCTTCAGAAATAAAA
AAATTAGAACTAGAAATAGAAAATATAGATAAAGAAAAAGAAGAAGCAGTAAGATGTCAAGACTTTGAGAAAGCAGCCAAAATAAGAGAT
GAACAAGGTCTACTTAAAAAACAATTAGAAGATGTTAGAGAAAGATGGAACAAGTCATCTAAACATTCAGATTTAGTTGATGGAGAAGTT
ATTGCTGAAGTAGTGGGCTTATGGACAGGAATACCAGTTAATAAAATTCTTGAAGAAGAGGCTGATAGACTTTTGAGACTTGAGGAAATA
CTGCACAATAGAGTTATAGGTCAAGAACAAGCAGTAAAATCTATTTCAAAGGCAATCAGAAGGTCAAGAGCAGGTCTTAAAGACCCTAAT
AGACCAATTGGTTCATTTTTATTTTTAGGTCCAACAGGAGTAGGTAAAACAGAATTATCTAAGGCATTAGCAGAAGTGCAATTTGGAGAT
GAAAATCAAATAATTAGAATAGATATGTCTGAATATATGGAAAAACATGCTGTGTCAAGAATGATAGGTTCACCTCCAGGTTATGTAGGT
CATGATGAAGGTGGTCAATTAACTGAAAAAGTAAGAAGAAATCCATATTCAGTTATCTTATTTGATGAGATAGAAAAAGCTCATCCAGAT
GTATTTAATATTCTGTTACAAATTCTAGATGATGGTAGACTAACTGATTCAAAAGGAAGAACTGTAGATTTTAAGAATACTATTGTAATA
ATGACATCAAATGTTGGAGCATCTACAATTGGTAGACAAAAAACTTTAGGATTTAGTATAGCTAAAGGAGACGAAGAAGAAAAATCTCAA
TATGAAAAAATGAAAGAAAATATAATGGGTGAATTAAAACAAAGATTCAGACCAGAGTTTTTAAACAGAATAGATGATATAATTGTTTTC
CACTCACTAAATGAAAATCATATATCAAAAATAGTACTTTTAATGGCAGCGAAACTACAAGAGAGATTAAAAGAAATGGATATAAAATTA
GAAATGAGTGATGAGGCTGTTAAATTAATTTCTAAATCTGGATTTGACTTAGAATATGGAGCAAGACCTCTTAAAAGAGCTTTACAAAAA
GAGTTGGAAGATGAGCTATCTGAAGCAATCTTAAAAGGTAATGTGAAAAAGGGAAGTAATGTAGTAGCAAAAGTCAAAGATGAAAAAATA
GTTTTTGAAACTAAATAA

Gene Information
Molecule Type genomic DNA
Bases 2448 Bases
Molecular Weight762119.46 Da
Coding Sequence AM180355.1:42914..45361
NCBI ReferenceCAJ66840
NotesEvidence 2a : Function of homologous gene

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 17 to 67 51 Clp amino terminal domain PF02861
N Domain 91 to 143 53 Clp amino terminal domain PF02861
NBD_1 209 to 345 137 Nucleotide binding domain 1 PF00004
UVR 423 to 458 36 UvrB/UvrC motif PF02151
NBD_2 541 to 717 177 Nucleotide binding domain 2 PF07724
Clp_C 723 to 812 90 C terminal, D2 small domain PF10431

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

3FES Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpC_CLDI1

Accession Number

HSP100_0204

Added on

2012-02-02

Updated On

2014-01-20