Help  Custom Search
 
class III stress response-related ATPase. of Bacillus subtilis subsp. subtilis str. 168

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

class III stress response-related ATPase.

Synonymous Names

CLPC_BACSU, Caseinolytic peptidase C, ClpC.

Gene names

Gene Name

clpC

Gene Locus Tag

BSU00860

Gene Identifier

938481

Taxon Information

Organism

Bacillus subtilis subsp. subtilis str. 168

Organism ID

224308 [NCBI] [UNIPROT]

Lineage

Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus; Bacillus subtilis subsp. subtilis str. 168

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpC-Caseinolytic peptidase C)

SEQUENCE INFORMATION

Sequence
MMFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGIAAKALQALGLGSEKIQKEVESLIGR GQEMSQTIHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQ LLGSNETGSSAAGTNSNANTPTLDSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEP GVGKTAIAEGLAQQIINNEVPEILRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE LHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVDQPSVDESIQI LQGLRDRYEAHHRVSITDDAIEAAVKLSDRYISDRFLPDKAIDLIDEAGSKVRLRSFTTPPNLKELEQKL DEVRKEKDAAVQSQEFEKAASLRDTEQRLREQVEDTKKSWKEKQGQENSEVTVDDIAMVVSSWTGVPVSK IAQTETDKLLNMENILHSRVIGQDEAVVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAE SIFGDEESMIRIDMSEYMEKHSTSRLVGSPPGYVGYDEGGQLTEKVRRKPYSVVLLDEIEKAHPDVFNIL LQVLEDGRLTDSKGRTVDFRNTILIMTSNVGASELKRNKYVGFNVQDETQNHKDMKDKVMGELKRAFRPE FINRIDEIIVFHSLEKKHLTEIVSLMSDQLTKRLKEQDLSIELTDAAKAKVAEEGVDLEYGARPLRRAIQ KHVEDRLSEELLRGNIHKGQHIVLDVEDGEFVVKTTAKTN

FASTA Format Composition Secondary Structure

Nucleotide
 ATGATGTTTGGAAGATTTACAGAACGAGCTCAAAAAGTACTGGCGCTAGCACAGGAAGAAGCACTTCGGTTAGGTCATAATAACATTGG
CACTGAGCATATTTTATTAGGACTGGTAAGAGAAGGAGAGGGCATTGCTGCTAAAGCTCTTCAAGCGCTTGGACTCGGTTCAGAAAAAAT
TCAGAAAGAAGTAGAAAGTTTGATCGGGCGCGGGCAGGAAATGTCTCAAACGATTCATTATACTCCTAGAGCTAAAAAAGTCATTGAGCT
TTCAATGGATGAGGCAAGAAAACTCGGTCATTCTTATGTGGGAACAGAACATATTCTTCTTGGTCTGATTCGTGAAGGAGAAGGTGTTGC
TGCGAGAGTTCTGAATAATCTCGGTGTCAGCTTAAATAAAGCAAGACAGCAGGTGCTCCAGCTTCTAGGAAGTAATGAAACAGGATCATC
AGCGGCAGGAACAAACAGCAATGCGAATACGCCTACGCTTGACAGCTTGGCAAGAGACTTAACTGCTATTGCGAAGGAAGACAGCCTTGA
CCCTGTAATCGGCAGAAGCAAGGAGATCCAGCGTGTCATTGAAGTGTTAAGCCGCAGAACGAAAAACAACCCTGTTCTCATTGGGGAACC
AGGTGTAGGTAAAACGGCTATCGCAGAAGGTTTGGCACAGCAAATTATCAATAATGAAGTACCCGAAATTTTGCGTGATAAACGTGTGAT
GACATTAGACATGGGAACAGTTGTTGCCGGCACAAAATACCGCGGAGAATTTGAGGATCGCCTGAAGAAGGTCATGGATGAAATTCGCCA
GGCAGGAAATATCATTCTATTCATCGATGAGCTCCATACATTAATCGGGGCAGGCGGAGCAGAAGGTGCTATTGATGCATCTAATATTTT
AAAACCTTCACTTGCTCGTGGCGAACTCCAATGTATTGGTGCAACGACTCTTGATGAGTACCGTAAATATATTGAAAAAGATGCAGCACT
GGAACGCCGTTTTCAGCCGATTCAGGTTGATCAGCCATCTGTAGATGAAAGTATTCAAATTTTACAAGGTCTGCGTGACAGATACGAAGC
CCACCACCGCGTTTCTATCACTGATGATGCCATTGAAGCTGCGGTTAAGCTTTCTGACAGATATATTTCTGACCGCTTCCTTCCGGATAA
AGCAATTGACTTGATCGATGAAGCGGGTTCAAAGGTGAGACTGCGCTCATTTACAACGCCTCCTAACTTAAAAGAGCTTGAGCAGAAGCT
TGATGAGGTTCGTAAAGAGAAGGATGCGGCAGTGCAAAGCCAAGAGTTTGAAAAAGCTGCTTCCTTGCGTGATACTGAACAACGCCTGCG
CGAGCAAGTAGAGGATACGAAGAAATCATGGAAAGAGAAGCAAGGGCAGGAAAACTCAGAGGTTACTGTGGATGATATTGCGATGGTTGT
ATCCAGCTGGACCGGTGTGCCTGTATCTAAAATCGCCCAAACTGAAACTGATAAGCTTCTCAATATGGAAAACATTCTTCACTCCCGTGT
CATCGGCCAGGATGAAGCAGTTGTAGCGGTTGCAAAAGCCGTCAGACGTGCAAGAGCAGGATTGAAAGATCCTAAACGCCCAATCGGCTC
ATTCATTTTCTTAGGCCCTACAGGTGTAGGTAAAACAGAACTTGCACGAGCACTTGCTGAATCCATTTTTGGCGATGAAGAATCCATGAT
CAGAATTGATATGTCTGAATACATGGAAAAACATTCAACTTCAAGACTTGTTGGTTCACCTCCGGGTTATGTGGGATATGATGAAGGCGG
TCAATTGACAGAGAAAGTCAGAAGAAAACCTTACTCTGTCGTGCTTCTTGATGAGATCGAGAAAGCGCACCCTGATGTCTTCAATATCCT
TCTGCAAGTTCTTGAAGACGGACGATTGACTGATTCTAAAGGACGCACAGTCGATTTCCGCAATACCATTCTGATCATGACATCAAACGT
CGGAGCAAGTGAGCTAAAACGCAATAAATATGTCGGCTTTAACGTTCAGGATGAAACTCAAAATCATAAAGACATGAAAGATAAAGTGAT
GGGTGAATTAAAACGAGCGTTCAGACCTGAGTTCATCAACCGTATTGATGAAATCATTGTCTTCCATTCACTTGAGAAAAAACATCTCAC
TGAGATTGTGTCATTAATGTCTGATCAATTAACGAAACGCCTGAAAGAACAAGATCTTTCTATCGAATTGACAGATGCTGCAAAAGCGAA
AGTCGCGGAAGAGGGCGTTGACCTGGAATACGGTGCCCGTCCGTTAAGAAGAGCGATCCAAAAACATGTCGAGGATCGTTTATCTGAAGA
ACTCCTCAGAGGAAATATTCATAAAGGACAGCATATTGTTCTTGATGTAGAAGATGGCGAATTTGTCGTAAAAACGACTGCTAAAACGAA
TTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine77832 %
Guanine59025 %
Thyamine59625 %
Cytosine46920 %
A+T137457 %
G+C105944 %

Total Bases :   2433 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA17223
AAAAAA25223
ATATAT96523
ATATAT113923
AAAAAA214523

Microsatellite Map

ATGATGTTTGGAAGATTTACAGAACGAGCTCAAAAAGTACTGGCGCTAGCACAGGAAGAAGCACTTCGGTTAGGTCATAATAACATTGGC
ACTGAGCATATTTTATTAGGACTGGTAAGAGAAGGAGAGGGCATTGCTGCTAAAGCTCTTCAAGCGCTTGGACTCGGTTCAGAAAAAATT
CAGAAAGAAGTAGAAAGTTTGATCGGGCGCGGGCAGGAAATGTCTCAAACGATTCATTATACTCCTAGAGCTAAAAAAGTCATTGAGCTT
TCAATGGATGAGGCAAGAAAACTCGGTCATTCTTATGTGGGAACAGAACATATTCTTCTTGGTCTGATTCGTGAAGGAGAAGGTGTTGCT
GCGAGAGTTCTGAATAATCTCGGTGTCAGCTTAAATAAAGCAAGACAGCAGGTGCTCCAGCTTCTAGGAAGTAATGAAACAGGATCATCA
GCGGCAGGAACAAACAGCAATGCGAATACGCCTACGCTTGACAGCTTGGCAAGAGACTTAACTGCTATTGCGAAGGAAGACAGCCTTGAC
CCTGTAATCGGCAGAAGCAAGGAGATCCAGCGTGTCATTGAAGTGTTAAGCCGCAGAACGAAAAACAACCCTGTTCTCATTGGGGAACCA
GGTGTAGGTAAAACGGCTATCGCAGAAGGTTTGGCACAGCAAATTATCAATAATGAAGTACCCGAAATTTTGCGTGATAAACGTGTGATG
ACATTAGACATGGGAACAGTTGTTGCCGGCACAAAATACCGCGGAGAATTTGAGGATCGCCTGAAGAAGGTCATGGATGAAATTCGCCAG
GCAGGAAATATCATTCTATTCATCGATGAGCTCCATACATTAATCGGGGCAGGCGGAGCAGAAGGTGCTATTGATGCATCTAATATTTTA
AAACCTTCACTTGCTCGTGGCGAACTCCAATGTATTGGTGCAACGACTCTTGATGAGTACCGTAAATATATTGAAAAAGATGCAGCACTG
GAACGCCGTTTTCAGCCGATTCAGGTTGATCAGCCATCTGTAGATGAAAGTATTCAAATTTTACAAGGTCTGCGTGACAGATACGAAGCC
CACCACCGCGTTTCTATCACTGATGATGCCATTGAAGCTGCGGTTAAGCTTTCTGACAGATATATTTCTGACCGCTTCCTTCCGGATAAA
GCAATTGACTTGATCGATGAAGCGGGTTCAAAGGTGAGACTGCGCTCATTTACAACGCCTCCTAACTTAAAAGAGCTTGAGCAGAAGCTT
GATGAGGTTCGTAAAGAGAAGGATGCGGCAGTGCAAAGCCAAGAGTTTGAAAAAGCTGCTTCCTTGCGTGATACTGAACAACGCCTGCGC
GAGCAAGTAGAGGATACGAAGAAATCATGGAAAGAGAAGCAAGGGCAGGAAAACTCAGAGGTTACTGTGGATGATATTGCGATGGTTGTA
TCCAGCTGGACCGGTGTGCCTGTATCTAAAATCGCCCAAACTGAAACTGATAAGCTTCTCAATATGGAAAACATTCTTCACTCCCGTGTC
ATCGGCCAGGATGAAGCAGTTGTAGCGGTTGCAAAAGCCGTCAGACGTGCAAGAGCAGGATTGAAAGATCCTAAACGCCCAATCGGCTCA
TTCATTTTCTTAGGCCCTACAGGTGTAGGTAAAACAGAACTTGCACGAGCACTTGCTGAATCCATTTTTGGCGATGAAGAATCCATGATC
AGAATTGATATGTCTGAATACATGGAAAAACATTCAACTTCAAGACTTGTTGGTTCACCTCCGGGTTATGTGGGATATGATGAAGGCGGT
CAATTGACAGAGAAAGTCAGAAGAAAACCTTACTCTGTCGTGCTTCTTGATGAGATCGAGAAAGCGCACCCTGATGTCTTCAATATCCTT
CTGCAAGTTCTTGAAGACGGACGATTGACTGATTCTAAAGGACGCACAGTCGATTTCCGCAATACCATTCTGATCATGACATCAAACGTC
GGAGCAAGTGAGCTAAAACGCAATAAATATGTCGGCTTTAACGTTCAGGATGAAACTCAAAATCATAAAGACATGAAAGATAAAGTGATG
GGTGAATTAAAACGAGCGTTCAGACCTGAGTTCATCAACCGTATTGATGAAATCATTGTCTTCCATTCACTTGAGAAAAAACATCTCACT
GAGATTGTGTCATTAATGTCTGATCAATTAACGAAACGCCTGAAAGAACAAGATCTTTCTATCGAATTGACAGATGCTGCAAAAGCGAAA
GTCGCGGAAGAGGGCGTTGACCTGGAATACGGTGCCCGTCCGTTAAGAAGAGCGATCCAAAAACATGTCGAGGATCGTTTATCTGAAGAA
CTCCTCAGAGGAAATATTCATAAAGGACAGCATATTGTTCTTGATGTAGAAGATGGCGAATTTGTCGTAAAAACGACTGCTAAAACGAAT
TAA

Gene Information
Molecule Type unassigned DNA
Bases 2433 Bases
Molecular Weight754777.94 Da
Coding Sequence U02604.1:335..2767
NCBI ReferenceAAA19233
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 17 to 69 53 Clp amino terminal domain PF02861
N Domain 91 to 143 53 Clp amino terminal domain PF02861
NBD_1 204 to 339 136 Nucleotide binding domain 1 PF00004
UVR 417 to 452 36 UvrB/UvrC motif PF02151
NBD_2 536 to 708 173 Nucleotide binding domain 2 PF07724
Clp_C 714 to 803 90 C terminal, D2 small domain PF10431

Graphical View

STRUCTURE   hide

3D Structure

PDB Id

View in Jmol

2K77 Jmol
2Y1Q Jmol
2Y1R Jmol
3PXG Jmol
3PXI Jmol

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpC_BASU1

Accession Number

HSP100_0096

Added on

2012-02-02

Updated On

2014-01-20