Help  Custom Search
 
ATP-dependent Clp protease, ATP-binding subunit ClpX. of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent Clp protease, ATP-binding subunit ClpX.

Synonymous Names

CLPX_ACIB5, Caseinolytic peptidase X, ClpX.

Gene names

Gene Name

clpX

Gene Locus Tag

AB57_0581

Gene Identifier

7043631

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii complex; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpX-Caseinolytic peptidase X)

SEQUENCE INFORMATION

Sequence
MSEHPQGQKHCSFCGKTQSEVGKLIAGEDAYICNECVDVCLDLVQTSQQVEAGDWASKALPKPHEIRAAL DQYVIGQDLAKKTLSVAVYNHYKRLKVGQSGHVSKDVEIAKSNILLIGPTGSGKTLLAQTLARLLDVPFA MADATTLTEAGYVGEDVENIVQKLLQKADYDVEKAQKGIIYIDEIDKITRKSENPSITRDVSGEGVQQAL LKMIEGTVASIPPQGGRKHPQQEFIQIDTSNILFICGGAFAGLEKIVQQRQEKGGIGFTADVKNKDETKK LAELFRQVEPTDLVKFGLIPEFIGRLPVIATLEELDEEALMQILTEPKNALTRQYQYLFNMENVDLVFED SALRAVAKRALERNTGARGLRSILENVLLETMYDLPSRTDVGTVFINEAVINGEAEPVYKSERQPKEAVT HESVAKADLKVIDSKSA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTCCGAACATCCTCAAGGACAAAAACATTGTTCATTTTGCGGTAAAACGCAGTCTGAAGTCGGGAAACTGATTGCGGGCGAGGACGC
ATATATTTGTAATGAGTGTGTAGATGTCTGCTTAGACCTTGTACAAACCAGCCAACAGGTTGAAGCAGGTGACTGGGCGAGCAAGGCATT
GCCAAAACCACATGAAATACGTGCTGCGCTTGATCAATATGTAATTGGTCAGGATCTTGCCAAAAAGACATTATCTGTTGCCGTTTATAA
CCATTATAAGCGTTTGAAAGTCGGGCAATCTGGTCATGTGTCTAAAGATGTGGAAATTGCTAAAAGTAACATTCTACTGATTGGGCCTAC
CGGTTCAGGTAAAACATTACTTGCTCAAACATTGGCTCGTTTGTTAGATGTGCCGTTTGCAATGGCAGATGCGACTACTTTGACTGAAGC
GGGTTATGTTGGCGAAGACGTTGAAAATATCGTACAAAAGCTTTTGCAAAAAGCAGATTACGATGTAGAAAAAGCTCAAAAGGGCATTAT
CTACATTGATGAAATCGACAAGATTACACGTAAATCTGAAAATCCGTCGATTACTCGTGACGTGTCTGGTGAAGGTGTACAACAAGCTTT
GCTTAAGATGATTGAAGGTACTGTAGCCTCAATTCCACCACAAGGTGGACGTAAGCATCCACAGCAAGAGTTCATTCAAATTGATACCTC
AAATATTCTATTTATTTGTGGTGGTGCGTTTGCTGGACTGGAAAAAATTGTACAACAGCGTCAAGAGAAAGGCGGAATTGGCTTTACAGC
TGATGTTAAAAACAAAGATGAAACCAAAAAACTTGCTGAATTATTCCGTCAAGTTGAGCCAACTGATTTAGTTAAATTTGGTTTAATTCC
AGAATTCATTGGCCGTTTACCAGTGATTGCAACGCTTGAAGAGCTTGATGAAGAAGCATTAATGCAAATTTTGACTGAACCGAAAAATGC
ATTAACTCGTCAGTATCAATACCTGTTCAATATGGAAAATGTTGACCTCGTATTTGAAGATTCAGCTTTACGTGCAGTGGCTAAGCGTGC
GCTTGAGCGTAATACCGGAGCTCGTGGCCTACGCTCGATTTTGGAAAATGTTCTACTTGAAACGATGTATGACTTGCCAAGCCGTACAGA
TGTAGGAACAGTTTTCATTAATGAAGCAGTTATTAATGGTGAAGCTGAACCTGTCTACAAGTCAGAACGTCAGCCTAAAGAAGCAGTAAC
ACATGAAAGTGTTGCTAAGGCAGATTTAAAAGTAATTGATTCGAAGTCTGCTTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine41532 %
Guanine30123 %
Thyamine36628 %
Cytosine23218 %
A+T78160 %
G+C53341 %

Total Bases :   1314 bases

Microsatellites
SequencePosition LengthRepeats
ATATAT8923
GTGTGT10423
GTGGTGGTG73633
AAAAAA76023
AAAAAA83423

Microsatellite Map

ATGTCCGAACATCCTCAAGGACAAAAACATTGTTCATTTTGCGGTAAAACGCAGTCTGAAGTCGGGAAACTGATTGCGGGCGAGGACGCA
TATATTTGTAATGAGTGTGTAGATGTCTGCTTAGACCTTGTACAAACCAGCCAACAGGTTGAAGCAGGTGACTGGGCGAGCAAGGCATTG
CCAAAACCACATGAAATACGTGCTGCGCTTGATCAATATGTAATTGGTCAGGATCTTGCCAAAAAGACATTATCTGTTGCCGTTTATAAC
CATTATAAGCGTTTGAAAGTCGGGCAATCTGGTCATGTGTCTAAAGATGTGGAAATTGCTAAAAGTAACATTCTACTGATTGGGCCTACC
GGTTCAGGTAAAACATTACTTGCTCAAACATTGGCTCGTTTGTTAGATGTGCCGTTTGCAATGGCAGATGCGACTACTTTGACTGAAGCG
GGTTATGTTGGCGAAGACGTTGAAAATATCGTACAAAAGCTTTTGCAAAAAGCAGATTACGATGTAGAAAAAGCTCAAAAGGGCATTATC
TACATTGATGAAATCGACAAGATTACACGTAAATCTGAAAATCCGTCGATTACTCGTGACGTGTCTGGTGAAGGTGTACAACAAGCTTTG
CTTAAGATGATTGAAGGTACTGTAGCCTCAATTCCACCACAAGGTGGACGTAAGCATCCACAGCAAGAGTTCATTCAAATTGATACCTCA
AATATTCTATTTATTTGTGGTGGTGCGTTTGCTGGACTGGAAAAAATTGTACAACAGCGTCAAGAGAAAGGCGGAATTGGCTTTACAGCT
GATGTTAAAAACAAAGATGAAACCAAAAAACTTGCTGAATTATTCCGTCAAGTTGAGCCAACTGATTTAGTTAAATTTGGTTTAATTCCA
GAATTCATTGGCCGTTTACCAGTGATTGCAACGCTTGAAGAGCTTGATGAAGAAGCATTAATGCAAATTTTGACTGAACCGAAAAATGCA
TTAACTCGTCAGTATCAATACCTGTTCAATATGGAAAATGTTGACCTCGTATTTGAAGATTCAGCTTTACGTGCAGTGGCTAAGCGTGCG
CTTGAGCGTAATACCGGAGCTCGTGGCCTACGCTCGATTTTGGAAAATGTTCTACTTGAAACGATGTATGACTTGCCAAGCCGTACAGAT
GTAGGAACAGTTTTCATTAATGAAGCAGTTATTAATGGTGAAGCTGAACCTGTCTACAAGTCAGAACGTCAGCCTAAAGAAGCAGTAACA
CATGAAAGTGTTGCTAAGGCAGATTTAAAAGTAATTGATTCGAAGTCTGCTTAG

Gene Information
Molecule Type genomic DNA
Bases 1314 Bases
Molecular Weight407439.36 Da
Coding Sequence CP001182.1:615655..616968
NCBI ReferenceACJ40002
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Zf_C4 8 to 47 40 C4_type Zinc finger domain PF06689
NBD_2 109 to 309 201 Nucleotide binding domain 2 PF07724
Clp_C 315 to 405 91 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpX_ACBA1

Accession Number

HSP100_0025

Added on

2012-02-02

Updated On

2014-01-20