Help  Custom Search
 
ATP-dependent Clp protease ATP-binding subunit. of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent Clp protease ATP-binding subunit.

Synonymous Names

B7I930_ACIB5, Caseinolytic peptidase A, ClpA.

Gene names

Gene Name

clpA

Gene Locus Tag

AB57_2244

Gene Identifier

7045072

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii complex; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpA-Caseinolytic peptidase A)

SEQUENCE INFORMATION

Sequence
MLSRQLEVSLRLAVSMARQKRHEFLTVEHLLLALLDNDSAVNALKACGADIVSLRKELEEYVEQHTPKLG ENSEQAPHPTESFDRILQRAIFHVQSSGGDRTVEGADVLVAMYSERDSFAVYLLKRHQINRLTLTQYLSH GTRKDEVQVEEEVEDIEGESNSGNAGPLELYTLNLNVEAQKGKTDPLIGREKEIERTAQILCRRRKNNPL LVGDPGVGKTSIAEGLAWLIVNGKAPKPLSHAEIYSLDIGALVAGTKYRGDFEKRLKQLLNALKKNPNAI LFIDEIHMIIGAGSSMGSTMDASNLIKPALANGTLRCIGSTTFQEYRQVFEKDHALSRRFQKIDVNEPSI SETIDILRGLKTKFEDFHHVQYDDKALVSAVELSAKFINDRFLPDKAIDVIDEAGAQRRLKAESEDSLIT VENIEDIVSKIARIPPKTVSKDDKSVLENLERDLKRVVFGQDEAITALASAIKLSRAGLKSPDKPVGSFV FAGPTGVGKTEVTKQLAKLLGVELVRFDMSEYMERHAVSRLIGAPPGYVGYDQGGLLTDAIHKNPHCVLL LDEIEKAHPDVFNLLLQIMDHGALTDNNGRKSDFRNVIIVLTTNIGAESISRASIGFTEQDHSSDNQEAM KRAFSPEFRNRLDGVIQFKALPTTVIESVVDKFLTELQAQLDEKRVVLDVDQSARDWLATNGYDRLMGAR PMQRLIQEHLKKPLAEMILFGELADHGGNVAVSVKKEDGKAVGLKLEVFEDHHTAEPA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCTCAGTCGTCAATTAGAAGTATCATTACGTTTGGCTGTTAGCATGGCTCGTCAAAAGAGACATGAGTTTCTTACAGTTGAACATTT
ACTATTAGCCTTACTCGATAACGATTCGGCTGTGAATGCATTAAAAGCATGCGGAGCTGATATTGTTTCTTTACGTAAAGAATTAGAAGA
ATATGTAGAACAACATACTCCTAAGCTTGGCGAAAATAGCGAGCAAGCTCCACATCCAACAGAAAGTTTCGACCGCATTTTGCAACGTGC
AATTTTCCACGTTCAATCAAGTGGTGGTGACCGTACTGTTGAAGGTGCGGATGTTTTAGTCGCAATGTATTCAGAGCGTGATTCTTTTGC
TGTTTATCTGCTTAAACGTCATCAAATTAATCGATTGACTTTAACTCAATACTTGTCTCATGGGACACGTAAAGACGAAGTTCAGGTTGA
AGAAGAAGTTGAAGACATTGAGGGTGAAAGCAATTCAGGCAATGCCGGACCATTAGAACTTTATACGCTCAATTTAAATGTTGAAGCGCA
AAAAGGTAAAACTGATCCACTCATTGGTCGTGAGAAAGAAATTGAGCGTACAGCACAAATTCTTTGCCGTCGTCGTAAAAACAATCCATT
GTTGGTAGGCGACCCGGGTGTAGGTAAAACTTCAATTGCAGAAGGCCTTGCATGGCTTATTGTAAATGGTAAAGCACCAAAACCGCTAAG
CCATGCAGAAATTTACAGCCTTGATATTGGTGCATTGGTTGCGGGTACAAAATATCGTGGTGACTTTGAAAAACGTTTAAAACAATTGTT
AAACGCTTTGAAGAAAAATCCGAATGCGATTTTATTCATTGATGAAATTCATATGATCATTGGTGCAGGCTCAAGTATGGGCAGTACGAT
GGATGCTTCGAATCTCATTAAACCAGCTTTAGCAAATGGTACTTTACGCTGCATTGGATCAACAACGTTCCAAGAATATCGTCAGGTATT
TGAAAAGGATCATGCGTTATCTCGTCGTTTCCAAAAAATTGACGTAAATGAACCGAGCATTTCTGAAACTATTGATATTTTACGTGGCTT
GAAAACGAAGTTTGAAGATTTCCACCATGTACAGTATGACGACAAAGCTTTGGTTTCTGCGGTTGAGCTTTCTGCGAAATTTATTAATGA
TCGTTTCTTGCCAGATAAAGCGATTGATGTCATTGATGAAGCAGGTGCACAGCGCCGTTTAAAAGCAGAAAGTGAAGACAGCTTAATTAC
TGTAGAAAACATCGAAGATATTGTTTCTAAGATTGCGCGTATTCCGCCTAAAACTGTATCTAAAGATGATAAATCTGTACTTGAAAATCT
TGAGCGTGACCTAAAACGTGTTGTATTTGGTCAAGATGAAGCAATTACTGCACTAGCTTCTGCAATCAAGTTGTCACGTGCTGGTTTGAA
ATCGCCAGATAAACCAGTTGGTAGCTTTGTGTTTGCTGGTCCTACCGGTGTAGGTAAAACTGAGGTTACGAAGCAATTAGCAAAACTTTT
AGGTGTAGAGCTTGTTCGTTTCGATATGTCTGAGTATATGGAGCGTCATGCTGTTTCTCGCTTAATTGGTGCTCCTCCAGGGTATGTGGG
TTATGACCAAGGTGGCTTACTCACAGATGCGATTCATAAAAATCCACACTGTGTATTGTTACTGGATGAAATTGAGAAAGCACATCCTGA
TGTGTTTAACCTGTTATTACAAATCATGGATCATGGTGCATTAACAGACAATAATGGTCGTAAGTCAGACTTTAGAAATGTCATTATTGT
GTTGACGACGAACATTGGTGCAGAAAGTATTTCTCGTGCAAGCATTGGATTTACAGAGCAAGACCATAGTTCGGACAACCAAGAAGCCAT
GAAACGTGCATTCTCACCTGAATTCCGTAACCGTCTAGATGGTGTTATTCAATTCAAAGCTTTACCAACCACAGTGATTGAATCTGTAGT
TGATAAGTTCTTGACAGAATTGCAAGCGCAGCTAGATGAAAAACGCGTAGTTTTAGATGTCGATCAAAGTGCACGCGACTGGTTAGCGAC
AAATGGTTATGATCGTTTAATGGGCGCTCGACCAATGCAACGACTCATTCAAGAACACTTGAAGAAACCATTAGCTGAAATGATACTGTT
TGGTGAACTTGCAGATCATGGCGGTAATGTGGCGGTATCAGTGAAGAAAGAAGATGGTAAAGCAGTGGGTCTAAAACTTGAAGTGTTTGA
AGACCACCATACGGCAGAACCAGCTTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine70231 %
Guanine51223 %
Thyamine66230 %
Cytosine40118 %
A+T136460 %
G+C91341 %

Total Bases :   2277 bases

Microsatellites
SequencePosition LengthRepeats
GTGGTGGTG28933
GAAGAAGAA44733
CGTCGTCGT60633
AAAAAA102123

Microsatellite Map

ATGCTCAGTCGTCAATTAGAAGTATCATTACGTTTGGCTGTTAGCATGGCTCGTCAAAAGAGACATGAGTTTCTTACAGTTGAACATTTA
CTATTAGCCTTACTCGATAACGATTCGGCTGTGAATGCATTAAAAGCATGCGGAGCTGATATTGTTTCTTTACGTAAAGAATTAGAAGAA
TATGTAGAACAACATACTCCTAAGCTTGGCGAAAATAGCGAGCAAGCTCCACATCCAACAGAAAGTTTCGACCGCATTTTGCAACGTGCA
ATTTTCCACGTTCAATCAAGTGGTGGTGACCGTACTGTTGAAGGTGCGGATGTTTTAGTCGCAATGTATTCAGAGCGTGATTCTTTTGCT
GTTTATCTGCTTAAACGTCATCAAATTAATCGATTGACTTTAACTCAATACTTGTCTCATGGGACACGTAAAGACGAAGTTCAGGTTGAA
GAAGAAGTTGAAGACATTGAGGGTGAAAGCAATTCAGGCAATGCCGGACCATTAGAACTTTATACGCTCAATTTAAATGTTGAAGCGCAA
AAAGGTAAAACTGATCCACTCATTGGTCGTGAGAAAGAAATTGAGCGTACAGCACAAATTCTTTGCCGTCGTCGTAAAAACAATCCATTG
TTGGTAGGCGACCCGGGTGTAGGTAAAACTTCAATTGCAGAAGGCCTTGCATGGCTTATTGTAAATGGTAAAGCACCAAAACCGCTAAGC
CATGCAGAAATTTACAGCCTTGATATTGGTGCATTGGTTGCGGGTACAAAATATCGTGGTGACTTTGAAAAACGTTTAAAACAATTGTTA
AACGCTTTGAAGAAAAATCCGAATGCGATTTTATTCATTGATGAAATTCATATGATCATTGGTGCAGGCTCAAGTATGGGCAGTACGATG
GATGCTTCGAATCTCATTAAACCAGCTTTAGCAAATGGTACTTTACGCTGCATTGGATCAACAACGTTCCAAGAATATCGTCAGGTATTT
GAAAAGGATCATGCGTTATCTCGTCGTTTCCAAAAAATTGACGTAAATGAACCGAGCATTTCTGAAACTATTGATATTTTACGTGGCTTG
AAAACGAAGTTTGAAGATTTCCACCATGTACAGTATGACGACAAAGCTTTGGTTTCTGCGGTTGAGCTTTCTGCGAAATTTATTAATGAT
CGTTTCTTGCCAGATAAAGCGATTGATGTCATTGATGAAGCAGGTGCACAGCGCCGTTTAAAAGCAGAAAGTGAAGACAGCTTAATTACT
GTAGAAAACATCGAAGATATTGTTTCTAAGATTGCGCGTATTCCGCCTAAAACTGTATCTAAAGATGATAAATCTGTACTTGAAAATCTT
GAGCGTGACCTAAAACGTGTTGTATTTGGTCAAGATGAAGCAATTACTGCACTAGCTTCTGCAATCAAGTTGTCACGTGCTGGTTTGAAA
TCGCCAGATAAACCAGTTGGTAGCTTTGTGTTTGCTGGTCCTACCGGTGTAGGTAAAACTGAGGTTACGAAGCAATTAGCAAAACTTTTA
GGTGTAGAGCTTGTTCGTTTCGATATGTCTGAGTATATGGAGCGTCATGCTGTTTCTCGCTTAATTGGTGCTCCTCCAGGGTATGTGGGT
TATGACCAAGGTGGCTTACTCACAGATGCGATTCATAAAAATCCACACTGTGTATTGTTACTGGATGAAATTGAGAAAGCACATCCTGAT
GTGTTTAACCTGTTATTACAAATCATGGATCATGGTGCATTAACAGACAATAATGGTCGTAAGTCAGACTTTAGAAATGTCATTATTGTG
TTGACGACGAACATTGGTGCAGAAAGTATTTCTCGTGCAAGCATTGGATTTACAGAGCAAGACCATAGTTCGGACAACCAAGAAGCCATG
AAACGTGCATTCTCACCTGAATTCCGTAACCGTCTAGATGGTGTTATTCAATTCAAAGCTTTACCAACCACAGTGATTGAATCTGTAGTT
GATAAGTTCTTGACAGAATTGCAAGCGCAGCTAGATGAAAAACGCGTAGTTTTAGATGTCGATCAAAGTGCACGCGACTGGTTAGCGACA
AATGGTTATGATCGTTTAATGGGCGCTCGACCAATGCAACGACTCATTCAAGAACACTTGAAGAAACCATTAGCTGAAATGATACTGTTT
GGTGAACTTGCAGATCATGGCGGTAATGTGGCGGTATCAGTGAAGAAAGAAGATGGTAAAGCAGTGGGTCTAAAACTTGAAGTGTTTGAA
GACCACCATACGGCAGAACCAGCTTAA

Gene Information
Molecule Type genomic DNA
Bases 2277 Bases
Molecular Weight705708.56 Da
Coding Sequence complement(CP001182.1:2328430..2330706)
NCBI ReferenceACJ41615
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 13 to 63 51 Clp amino terminal domain PF02861
NBD_1 209 to 345 137 Nucleotide binding domain 1 PF00004
NBD_2 484 to 645 202 Nucleotide binding domain 2 PF07724
Clp_C 651 to 742 92 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpA_ACBA1

Accession Number

HSP100_0024

Added on

2012-02-02

Updated On

2014-01-20