Help  Custom Search
 
type VI secretion ATPase, ClpV1 family. of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

type VI secretion ATPase, ClpV1 family.

Synonymous Names

B7I1Z9_ACIB5, ClpVI.

Gene names

Gene Name

clpV

Gene Locus Tag

AB57_1490

Gene Identifier

7046090

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii complex; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MMSSLKILITKLSTAARTALEKSANACVLQQNYEIEIEHLFLELLNQPLENDLKILLKKYKISADALADD LKETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLF PIDSMKHKFLEICEKSVEQQEESKTSSQADELEQAATPTAKTQKTPALDQYTINLTEKAKNGGIDPVIGR EYEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPEALKNVHLHVLDMGLLQAGASVKG EFENRLKQVIQEVQSSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYF EKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQKHFNLQIDDEAIVTAVHASHRYISGRQLPDKAVSV LDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLENLKNQLESLQSEIQETQEQ WQKELELVRKIQELEAQSHSNESEAYDQINLIRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGKM VNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALALANE LYGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFY QVFDKGTLEDGEGRVIDFKNTTILLTSNTGSSAIMQACLNQPVEEWPTAEDLIEHLKPSLYKQFKPAFLG RMRIVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTEVQYSDDLVELLLSRCTEVDSGARNVDNILNSTV LPALATEILVALADQKLPKLIMIDAKDDEIQYLLDPVAKPAKKRTSKKLKSEV

FASTA Format Composition Secondary Structure

Nucleotide
 ATGATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAGAAAAATCTGCTAATGCTTGTGTTCTTCA
GCAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTTACTTAATCAGCCTTTAGAAAACGATTTAAAAATTTTATTAAAAAAATA
TAAAATCTCAGCCGATGCTTTAGCAGATGATTTAAAAGAAACAATTTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAA
ATCAATTGTTCGTTTATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACAAAATCCTGTCATTCGTAGTGGTCATTTACTGGTTGCATT
ATTAACTGCACCAGACCTCTATCAAATTGCAACGAGAGCTTCGAGTTTATTTGATCTTTTCCCGATAGACTCAATGAAACATAAGTTTCT
TGAAATTTGTGAAAAAAGTGTAGAACAACAAGAAGAATCAAAAACATCTTCACAAGCAGATGAATTAGAACAAGCCGCGACTCCAACTGC
AAAAACTCAAAAAACACCTGCTTTAGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAATGGTGGGATTGACCCTGTTATTGGGCG
TGAATATGAAATTCGTTTGATGCTTGATATTTTAATGCGCAGACGCCAGAACAACCCAATTTTAACTGGTGAGCCAGGTGTAGGTAAAAC
AGCTGTAGTTGAAGGGTTAGCTTTAAAAATTGCTCAAGGTTTAGTTCCTGAGGCATTAAAAAATGTACATTTGCATGTTTTAGATATGGG
GCTTTTGCAAGCTGGGGCAAGTGTTAAAGGTGAATTTGAAAACCGTTTAAAGCAAGTTATTCAAGAAGTCCAATCATCGGCTCATCCTAT
TATTTTATTTATTGATGAAGCGCATACGCTTATTGGAGCAGGTGGCCAAGCGGGGCAAAACGATGCTGCCAATCTTTTAAAACCTGCACT
TGCTCGTGGCGAGTTACGTACTATTGCTGCAACAACATGGGCAGAATATAAACAGTATTTTGAGAAAGATGCTGCATTGAGCCGCCGTTT
TCAGGTGGTAAAGGTTGAAGAACCGACCGAAGAAGTTGCTGTGGATATGCTACGTGCAATGATTCCCGTAATGCAAAAGCACTTTAATTT
ACAAATTGATGATGAAGCAATTGTAACGGCTGTACATGCCTCTCATCGCTATATTAGTGGTCGTCAGCTCCCAGACAAAGCAGTAAGTGT
TCTTGATACTGCAGCAGCGCGTGTAGCTTTGACCCAAAATGCACAACCAGTCAAACTTGATCAATTGAAAGCACAAGAACATAACTTAAA
GCTTGAGCAACAAATTTTGGAAAATGAACACCGTCAAATTCCAATACATCATGAAAGATTAGAAAATCTGAAAAACCAACTAGAGTCATT
ACAAAGTGAGATCCAAGAGACTCAGGAACAATGGCAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCAGAGCCATTC
TAATGAGTCTGAAGCCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGCCGTTAGTTTTTGAGCGAGT
AAACTCTCAGATTATCAATGAAATTATTTCTGATTGGACAGGTATTCCTGTTGGGAAAATGGTCAATGATGAAATTAAGCAGATTTTAAC
GCTTGAAGATAAATTAGGTGAGCGTGTAATGGGGCAAGATTATGCACTTACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATT
AGAAGATCCAAATAAACCTCAAGGGGTGTTCCTTTTAGTCGGGCCTAGTGGGGTTGGTAAAACTGAAACTGCTTTAGCCTTAGCTAATGA
GTTATATGGCGGTGAACAGCATTTAATCACGATTAATATGTCTGAGTATCAAGAAGCACATACTGTCTCTTCGCTTAAAGGTGCACCTCC
AGGCTATGTGGGCTATGGTCAGGGTGGGGTTTTAACTGAAGCTGTACGCCGTAATCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAA
AGCACATAGCGATGTTCAGGAGTTGTTCTATCAAGTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGACTTTAAAAA
CACGACAATCTTATTAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGAAGAATGGCCTACCGCAGA
AGATTTAATCGAACATTTAAAGCCGAGTTTATATAAACAGTTTAAGCCAGCCTTCTTAGGGCGCATGAGAATTGTGCCATATTTCCCATT
GCATGATGATTTATTGGTTCGAATTATTAAACATAAATTGGGCAAAATTACTGCTCGAATTGAAAAACAATATGGAACGGAAGTTCAATA
TTCAGATGACTTGGTCGAGTTGCTACTCAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTTGATAACATCTTAAATTCTACAGT
TTTACCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCGAAATTGATCATGATTGATGCAAAAGATGACGAGAT
CCAATATTTACTAGATCCTGTGGCGAAGCCTGCTAAAAAACGGACTAGTAAAAAGTTGAAATCAGAAGTTTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine90334 %
Guanine55221 %
Thyamine77429 %
Cytosine45317 %
A+T167763 %
G+C100538 %

Total Bases :   2682 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA17023
AAAAAA46023
AAAAAA54723
AAAAAA77623
TGATGATGA117533
TATATA227823
AAAAAA264323

Microsatellite Map

ATGATGAGTAGTTTAAAAATTTTAATTACAAAACTTTCTACAGCTGCACGCACTGCTTTAGAAAAATCTGCTAATGCTTGTGTTCTTCAG
CAAAACTACGAAATTGAAATTGAACATTTATTTTTAGAGTTACTTAATCAGCCTTTAGAAAACGATTTAAAAATTTTATTAAAAAAATAT
AAAATCTCAGCCGATGCTTTAGCAGATGATTTAAAAGAAACAATTTCTCAATTACCAAAAGGTAATACACGTACTCCAATTTTTGCTAAA
TCAATTGTTCGTTTATTTGAACAAGCTTGGTTATTGGCTTCAGCAGAACAAAATCCTGTCATTCGTAGTGGTCATTTACTGGTTGCATTA
TTAACTGCACCAGACCTCTATCAAATTGCAACGAGAGCTTCGAGTTTATTTGATCTTTTCCCGATAGACTCAATGAAACATAAGTTTCTT
GAAATTTGTGAAAAAAGTGTAGAACAACAAGAAGAATCAAAAACATCTTCACAAGCAGATGAATTAGAACAAGCCGCGACTCCAACTGCA
AAAACTCAAAAAACACCTGCTTTAGATCAATATACAATTAATTTAACTGAAAAAGCGAAGAATGGTGGGATTGACCCTGTTATTGGGCGT
GAATATGAAATTCGTTTGATGCTTGATATTTTAATGCGCAGACGCCAGAACAACCCAATTTTAACTGGTGAGCCAGGTGTAGGTAAAACA
GCTGTAGTTGAAGGGTTAGCTTTAAAAATTGCTCAAGGTTTAGTTCCTGAGGCATTAAAAAATGTACATTTGCATGTTTTAGATATGGGG
CTTTTGCAAGCTGGGGCAAGTGTTAAAGGTGAATTTGAAAACCGTTTAAAGCAAGTTATTCAAGAAGTCCAATCATCGGCTCATCCTATT
ATTTTATTTATTGATGAAGCGCATACGCTTATTGGAGCAGGTGGCCAAGCGGGGCAAAACGATGCTGCCAATCTTTTAAAACCTGCACTT
GCTCGTGGCGAGTTACGTACTATTGCTGCAACAACATGGGCAGAATATAAACAGTATTTTGAGAAAGATGCTGCATTGAGCCGCCGTTTT
CAGGTGGTAAAGGTTGAAGAACCGACCGAAGAAGTTGCTGTGGATATGCTACGTGCAATGATTCCCGTAATGCAAAAGCACTTTAATTTA
CAAATTGATGATGAAGCAATTGTAACGGCTGTACATGCCTCTCATCGCTATATTAGTGGTCGTCAGCTCCCAGACAAAGCAGTAAGTGTT
CTTGATACTGCAGCAGCGCGTGTAGCTTTGACCCAAAATGCACAACCAGTCAAACTTGATCAATTGAAAGCACAAGAACATAACTTAAAG
CTTGAGCAACAAATTTTGGAAAATGAACACCGTCAAATTCCAATACATCATGAAAGATTAGAAAATCTGAAAAACCAACTAGAGTCATTA
CAAAGTGAGATCCAAGAGACTCAGGAACAATGGCAAAAAGAATTAGAGCTAGTTCGTAAAATTCAGGAATTAGAAGCGCAGAGCCATTCT
AATGAGTCTGAAGCCTACGATCAGATTAATTTAATACGCAAAGACCTTGCTGATATTCAGGGACAACAGCCGTTAGTTTTTGAGCGAGTA
AACTCTCAGATTATCAATGAAATTATTTCTGATTGGACAGGTATTCCTGTTGGGAAAATGGTCAATGATGAAATTAAGCAGATTTTAACG
CTTGAAGATAAATTAGGTGAGCGTGTAATGGGGCAAGATTATGCACTTACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCTAAATTA
GAAGATCCAAATAAACCTCAAGGGGTGTTCCTTTTAGTCGGGCCTAGTGGGGTTGGTAAAACTGAAACTGCTTTAGCCTTAGCTAATGAG
TTATATGGCGGTGAACAGCATTTAATCACGATTAATATGTCTGAGTATCAAGAAGCACATACTGTCTCTTCGCTTAAAGGTGCACCTCCA
GGCTATGTGGGCTATGGTCAGGGTGGGGTTTTAACTGAAGCTGTACGCCGTAATCCTTATAGTGTTGTGTTACTCGACGAAATTGAAAAA
GCACATAGCGATGTTCAGGAGTTGTTCTATCAAGTATTTGATAAAGGTACTTTAGAGGATGGTGAAGGGCGCGTTATTGACTTTAAAAAC
ACGACAATCTTATTAACTTCAAATACGGGCTCGAGTGCAATTATGCAGGCATGTTTAAATCAGCCTGTAGAAGAATGGCCTACCGCAGAA
GATTTAATCGAACATTTAAAGCCGAGTTTATATAAACAGTTTAAGCCAGCCTTCTTAGGGCGCATGAGAATTGTGCCATATTTCCCATTG
CATGATGATTTATTGGTTCGAATTATTAAACATAAATTGGGCAAAATTACTGCTCGAATTGAAAAACAATATGGAACGGAAGTTCAATAT
TCAGATGACTTGGTCGAGTTGCTACTCAGCCGTTGTACTGAAGTGGATAGTGGCGCCCGTAATGTTGATAACATCTTAAATTCTACAGTT
TTACCTGCTTTGGCAACTGAAATTTTAGTGGCGTTAGCAGATCAAAAATTGCCGAAATTGATCATGATTGATGCAAAAGATGACGAGATC
CAATATTTACTAGATCCTGTGGCGAAGCCTGCTAAAAAACGGACTAGTAAAAAGTTGAAATCAGAAGTTTAA

Gene Information
Molecule Type genomic DNA
Bases 2682 Bases
Molecular Weight830939.93 Da
Coding Sequence CP001182.1:1573095..1575776
NCBI ReferenceACJ40508
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 29 to 76 48 Clp amino terminal domain PF02861
NBD_1 229 to 367 139 Nucleotide binding domain 1 PF00004
M Domain 452 to 504 53 Coiled coil Middle domain Manually identified
NBD_2 605 to 775 171 Nucleotide binding domain 2 PF07724
Clp_C 780 to 871 92 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACBA2

Accession Number

HSP100_0023

Added on

2012-02-02

Updated On

2014-01-20