Help  Custom Search
 
ATP-dependent chaperone ClpB. of Acinetobacter baumannii str. AB0057

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent chaperone ClpB.

Synonymous Names

B7IAG1_ACIB5, Caseinolytic peptidase B, ClpB.

Gene names

Gene Name

clpB

Gene Locus Tag

AB57_1322

Gene Identifier

7045842

Taxon Information

Organism

Acinetobacter baumannii str. AB0057

Organism ID

480119 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii complex; Acinetobacter baumannii AB0057

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MRFEKFTNRLQQALSDAQSLAMGKDHTAIAGIHILSTLLEEPSNISLLQQAGARLPELKQKLEQALKDAP TIANPTGDVNLNPEAVKALNLADRYAQKAGDEFLSTDWVLLGLAETGETKNILSAVGVTPDSLRKVIENI RGSDKVMSNNHEDQRDSLNKYTIDLTERALSGKLDPVIGRDDEIRRTIQVLSRRTKNNPVLIGEPGVGKT AIVEGLAQRIVNGEVPEGLKNKRVLSLDLGSLLAGAKYRGEFEERLKAVLKDLAKHEGEIILFIDELHTL VGAGKGDGAMDAGNMLKPALARGELRCVGATTLDEYRQYIEKDAALERRFQKVLVDEPSVEDTIAILRGL KEKYATHHGVQILDSAIIAAAKMSHRYITDRQLPDKAIDLIDEAASRIKMEIDSKPEALDKLDRRLIQLK MQLEAVKKDEDAGSKAEVTHLEKQIAEVEKEYNDLEEVWKAEKTLVEGTKQAQVELDKARIAFEKAQREG DLAEAARLQYGVIPELQKQLEQDEVAEENEEPKLIRTKVTENEIAEVVSAATGIPVAKMMQGEREKLLHM EEFLHDRVVGQDEAVVAVSNAVRRSRAGLSDPNRPSGSFLFLGPTGVGKTELTKALANFLFDSDDAMIRI DMSEFMEKHSVSRLVGAPPGYVGYEEGGVLTEAVRRKPYSVVLFDEVEKAHPDVFNILLQVLDDGRLTDS QGRVVDFKNTVIVMTSNLGSQDVRELGEGATDDEVRTIVMNAVSQHFRPEFINRIDELVIFHSLKKAQIR GIADIQLDRLRSRLVDRDMSLTVDDSAFDLLIDAGFDPVYGARPLKRAIQQQVENTLAQKILSGDFVAGD TILVKGENGHLVFDKLKLS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCGATTTGAAAAATTTACGAACCGCTTGCAGCAAGCCCTCTCAGATGCTCAATCCTTAGCGATGGGTAAAGACCATACAGCTATAGC
AGGTATTCATATTTTGAGTACTTTATTGGAAGAGCCGTCCAATATTAGTTTGTTGCAACAAGCAGGTGCACGGTTACCTGAACTTAAACA
AAAGCTAGAGCAGGCTTTAAAAGATGCTCCGACTATTGCTAACCCGACGGGCGATGTCAATTTAAACCCAGAAGCAGTTAAAGCACTCAA
CTTGGCAGATCGATACGCGCAAAAAGCTGGCGATGAATTTTTGTCAACTGACTGGGTTTTATTGGGCTTGGCAGAAACTGGTGAAACAAA
AAATATTTTAAGTGCCGTAGGTGTAACTCCCGACAGCTTACGCAAAGTAATTGAAAATATTCGAGGTAGTGACAAAGTCATGAGTAATAA
TCACGAAGACCAACGTGACTCACTTAATAAATATACGATTGATTTAACCGAGCGGGCTTTATCGGGGAAACTTGATCCGGTGATTGGACG
TGATGATGAGATCCGCCGTACCATTCAGGTCTTGTCACGCCGTACTAAAAATAACCCAGTACTCATTGGTGAACCTGGGGTAGGTAAAAC
CGCTATTGTTGAAGGTTTGGCACAACGTATTGTCAATGGTGAAGTACCAGAAGGCTTAAAGAATAAACGTGTTTTATCGTTAGATTTAGG
TTCATTGCTTGCAGGTGCCAAGTATCGTGGTGAGTTTGAAGAACGTTTAAAAGCTGTTTTAAAAGATTTGGCGAAACACGAAGGCGAAAT
CATCTTATTCATTGACGAGTTACATACACTCGTTGGTGCTGGTAAAGGTGACGGCGCGATGGATGCAGGTAATATGTTAAAACCTGCGTT
GGCTCGTGGTGAGTTGCGCTGTGTGGGTGCAACAACCTTAGATGAATATCGCCAATACATTGAAAAAGATGCAGCCTTGGAGCGTCGTTT
CCAAAAAGTGCTGGTCGATGAACCAAGTGTAGAAGATACCATTGCGATTTTACGTGGTTTGAAAGAAAAGTATGCGACTCACCATGGCGT
ACAGATTTTAGACTCAGCGATTATTGCTGCGGCGAAAATGTCTCACCGTTATATTACAGACCGTCAATTACCGGACAAGGCGATTGACCT
GATTGATGAGGCAGCTTCTCGTATTAAGATGGAAATCGATTCTAAGCCAGAAGCACTTGATAAACTTGATCGCCGTTTAATCCAGTTGAA
AATGCAATTGGAAGCGGTGAAAAAAGATGAAGACGCAGGCAGTAAGGCCGAAGTTACTCATCTTGAAAAACAGATCGCTGAAGTCGAGAA
AGAATACAACGATCTGGAAGAAGTGTGGAAAGCTGAGAAAACACTGGTAGAAGGCACTAAACAAGCTCAGGTTGAACTTGATAAAGCACG
TATTGCTTTTGAAAAAGCTCAGCGTGAAGGCGATTTGGCAGAAGCAGCACGTTTGCAATATGGCGTAATTCCAGAGCTTCAAAAACAATT
GGAGCAAGACGAAGTTGCTGAAGAAAACGAAGAGCCAAAACTCATTCGTACAAAAGTAACTGAAAATGAAATTGCCGAAGTCGTTAGTGC
TGCAACAGGTATTCCAGTTGCTAAAATGATGCAAGGTGAGCGTGAAAAACTCCTTCATATGGAAGAGTTCTTGCATGACCGTGTTGTAGG
GCAAGATGAAGCAGTCGTTGCGGTATCGAATGCTGTTCGCCGTTCACGTGCCGGTTTGTCTGACCCGAATCGTCCTAGCGGATCATTCTT
GTTCTTAGGACCAACAGGTGTTGGTAAAACTGAGTTGACTAAAGCTTTAGCTAACTTCTTGTTTGACAGTGATGATGCCATGATTCGTAT
CGATATGAGTGAATTCATGGAGAAACATTCTGTCAGCCGTTTAGTTGGTGCGCCTCCGGGTTATGTAGGTTACGAAGAGGGCGGTGTTTT
AACCGAAGCTGTTCGCCGTAAACCATATAGCGTAGTGTTGTTTGATGAGGTTGAAAAAGCGCATCCAGATGTCTTCAATATCTTGCTACA
AGTATTAGACGATGGACGCTTAACCGACTCACAAGGTCGTGTAGTGGACTTTAAAAACACGGTTATTGTGATGACATCGAACTTGGGGTC
ACAAGATGTACGTGAACTTGGTGAAGGTGCAACTGATGATGAAGTGCGTACTATTGTAATGAATGCGGTAAGTCAGCATTTCCGTCCGGA
GTTTATTAACCGGATTGATGAGCTGGTGATTTTCCATTCACTCAAAAAAGCACAGATTCGTGGCATTGCCGATATTCAGTTGGACCGCTT
ACGCTCACGACTTGTTGATCGTGATATGAGTTTAACTGTAGATGACAGTGCATTTGACTTATTGATTGACGCTGGTTTTGATCCTGTATA
CGGAGCGCGTCCATTGAAACGTGCAATTCAACAACAGGTTGAAAATACACTAGCTCAAAAAATCTTGTCAGGTGACTTTGTTGCGGGTGA
TACCATTTTAGTTAAAGGCGAAAATGGTCACTTAGTGTTTGATAAGCTGAAACTCAGCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine77831 %
Guanine63925 %
Thyamine69728 %
Cytosine46619 %
A+T147558 %
G+C110543 %

Total Bases :   2580 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA35623
TGATGATGA53933
TGTGTG91823
AAAAAA127823
TGATGATGA219233
AAAAAA229223
AAAAAA248523

Microsatellite Map

ATGCGATTTGAAAAATTTACGAACCGCTTGCAGCAAGCCCTCTCAGATGCTCAATCCTTAGCGATGGGTAAAGACCATACAGCTATAGCA
GGTATTCATATTTTGAGTACTTTATTGGAAGAGCCGTCCAATATTAGTTTGTTGCAACAAGCAGGTGCACGGTTACCTGAACTTAAACAA
AAGCTAGAGCAGGCTTTAAAAGATGCTCCGACTATTGCTAACCCGACGGGCGATGTCAATTTAAACCCAGAAGCAGTTAAAGCACTCAAC
TTGGCAGATCGATACGCGCAAAAAGCTGGCGATGAATTTTTGTCAACTGACTGGGTTTTATTGGGCTTGGCAGAAACTGGTGAAACAAAA
AATATTTTAAGTGCCGTAGGTGTAACTCCCGACAGCTTACGCAAAGTAATTGAAAATATTCGAGGTAGTGACAAAGTCATGAGTAATAAT
CACGAAGACCAACGTGACTCACTTAATAAATATACGATTGATTTAACCGAGCGGGCTTTATCGGGGAAACTTGATCCGGTGATTGGACGT
GATGATGAGATCCGCCGTACCATTCAGGTCTTGTCACGCCGTACTAAAAATAACCCAGTACTCATTGGTGAACCTGGGGTAGGTAAAACC
GCTATTGTTGAAGGTTTGGCACAACGTATTGTCAATGGTGAAGTACCAGAAGGCTTAAAGAATAAACGTGTTTTATCGTTAGATTTAGGT
TCATTGCTTGCAGGTGCCAAGTATCGTGGTGAGTTTGAAGAACGTTTAAAAGCTGTTTTAAAAGATTTGGCGAAACACGAAGGCGAAATC
ATCTTATTCATTGACGAGTTACATACACTCGTTGGTGCTGGTAAAGGTGACGGCGCGATGGATGCAGGTAATATGTTAAAACCTGCGTTG
GCTCGTGGTGAGTTGCGCTGTGTGGGTGCAACAACCTTAGATGAATATCGCCAATACATTGAAAAAGATGCAGCCTTGGAGCGTCGTTTC
CAAAAAGTGCTGGTCGATGAACCAAGTGTAGAAGATACCATTGCGATTTTACGTGGTTTGAAAGAAAAGTATGCGACTCACCATGGCGTA
CAGATTTTAGACTCAGCGATTATTGCTGCGGCGAAAATGTCTCACCGTTATATTACAGACCGTCAATTACCGGACAAGGCGATTGACCTG
ATTGATGAGGCAGCTTCTCGTATTAAGATGGAAATCGATTCTAAGCCAGAAGCACTTGATAAACTTGATCGCCGTTTAATCCAGTTGAAA
ATGCAATTGGAAGCGGTGAAAAAAGATGAAGACGCAGGCAGTAAGGCCGAAGTTACTCATCTTGAAAAACAGATCGCTGAAGTCGAGAAA
GAATACAACGATCTGGAAGAAGTGTGGAAAGCTGAGAAAACACTGGTAGAAGGCACTAAACAAGCTCAGGTTGAACTTGATAAAGCACGT
ATTGCTTTTGAAAAAGCTCAGCGTGAAGGCGATTTGGCAGAAGCAGCACGTTTGCAATATGGCGTAATTCCAGAGCTTCAAAAACAATTG
GAGCAAGACGAAGTTGCTGAAGAAAACGAAGAGCCAAAACTCATTCGTACAAAAGTAACTGAAAATGAAATTGCCGAAGTCGTTAGTGCT
GCAACAGGTATTCCAGTTGCTAAAATGATGCAAGGTGAGCGTGAAAAACTCCTTCATATGGAAGAGTTCTTGCATGACCGTGTTGTAGGG
CAAGATGAAGCAGTCGTTGCGGTATCGAATGCTGTTCGCCGTTCACGTGCCGGTTTGTCTGACCCGAATCGTCCTAGCGGATCATTCTTG
TTCTTAGGACCAACAGGTGTTGGTAAAACTGAGTTGACTAAAGCTTTAGCTAACTTCTTGTTTGACAGTGATGATGCCATGATTCGTATC
GATATGAGTGAATTCATGGAGAAACATTCTGTCAGCCGTTTAGTTGGTGCGCCTCCGGGTTATGTAGGTTACGAAGAGGGCGGTGTTTTA
ACCGAAGCTGTTCGCCGTAAACCATATAGCGTAGTGTTGTTTGATGAGGTTGAAAAAGCGCATCCAGATGTCTTCAATATCTTGCTACAA
GTATTAGACGATGGACGCTTAACCGACTCACAAGGTCGTGTAGTGGACTTTAAAAACACGGTTATTGTGATGACATCGAACTTGGGGTCA
CAAGATGTACGTGAACTTGGTGAAGGTGCAACTGATGATGAAGTGCGTACTATTGTAATGAATGCGGTAAGTCAGCATTTCCGTCCGGAG
TTTATTAACCGGATTGATGAGCTGGTGATTTTCCATTCACTCAAAAAAGCACAGATTCGTGGCATTGCCGATATTCAGTTGGACCGCTTA
CGCTCACGACTTGTTGATCGTGATATGAGTTTAACTGTAGATGACAGTGCATTTGACTTATTGATTGACGCTGGTTTTGATCCTGTATAC
GGAGCGCGTCCATTGAAACGTGCAATTCAACAACAGGTTGAAAATACACTAGCTCAAAAAATCTTGTCAGGTGACTTTGTTGCGGGTGAT
ACCATTTTAGTTAAAGGCGAAAATGGTCACTTAGTGTTTGATAAGCTGAAACTCAGCTAA

Gene Information
Molecule Type genomic DNA
Bases 2580 Bases
Molecular Weight800765.89 Da
Coding Sequence CP001182.1:1406251..1408830
NCBI ReferenceACJ40344
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 17 to 67 51 Clp amino terminal domain PF02861
N Domain 92 to 142 51 Clp amino terminal domain PF02861
NBD_1 199 to 336 138 Nucleotide binding domain 1 PF00004
M Domain 427 to 495 69 C terminal, D2 small domain Manually identified
NBD_2 594 to 758 165 Nucleotide binding domain 2 PF07724
Clp_C 764 to 853 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACBA1

Accession Number

HSP100_0022

Added on

2012-02-02

Updated On

2014-01-20