Help  Custom Search
 
ATP-dependent protease ATP-binding subunit ClpX. of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent protease ATP-binding subunit ClpX.

Synonymous Names

CLPX_ACIC1, Caseinolytic peptidase X, ClpX.

Gene names

Gene Name

clpX

Gene Locus Tag

Acel_0739

Gene Identifier

4486487

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpX-Caseinolytic peptidase X)

SEQUENCE INFORMATION

Sequence
MARLGDGGDLLKCSFCGKSQKQVKKLIAGPGVYICDECIDLCNEIIEEELSESHEPKFDQLPKPREICEF LDQYVIGQETAKKALSVAVYNHYKRIQVGGSSRSSNDSVELAKSNILLIGPTGCGKTYLAQTLARMLNVP FAIADATALTEAGYVGEDVENILLKLIQAADYDVKRAETGIIYIDEIDKIARKSENPSITRDVSGEGVQQ ALLKILEGTTASVPPQGGRKHPHQEFIQIDTTNILFIVGGAFAGLEKIIEARIGKKGIGFTATLHGKRDL NTADIFSHVMPEDLLKYGMIPEFVGRLPVITTVTSLDREALIRILTEPKNALVRQYQRLFELDSVDLEFT DDALEAIADQAILRGTGARGLRAIMEEVLLSVMYDIPSRTDVARVVITRDVVLNNVNPTLVPRDSVVAKR ERREKTA

FASTA Format Composition Secondary Structure

Nucleotide
 GTGGCACGACTCGGCGACGGCGGTGACCTGCTCAAGTGTTCGTTCTGCGGCAAGAGCCAGAAGCAGGTGAAGAAGCTCATCGCGGGTCC
CGGCGTCTACATCTGCGACGAGTGCATTGATCTCTGCAATGAGATCATCGAAGAGGAGCTCTCCGAGTCGCACGAGCCGAAGTTCGACCA
GCTGCCCAAACCCCGGGAGATCTGCGAATTTCTCGATCAGTACGTTATCGGTCAAGAGACCGCAAAGAAGGCGTTGTCCGTCGCCGTCTA
TAACCACTACAAGCGGATCCAAGTCGGTGGTTCCAGCCGCAGCAGCAATGATTCGGTGGAACTTGCCAAATCGAACATCCTGCTCATCGG
CCCGACCGGCTGCGGCAAGACGTACCTCGCCCAGACCCTCGCCCGGATGCTCAATGTACCGTTCGCGATCGCGGATGCGACGGCGCTCAC
CGAAGCCGGTTACGTGGGTGAGGATGTCGAGAACATCCTGCTCAAATTGATCCAGGCCGCCGATTACGACGTGAAGCGGGCCGAGACCGG
CATCATCTACATCGACGAGATCGACAAAATCGCCCGCAAGAGTGAGAATCCGTCGATCACCCGCGACGTCTCTGGCGAGGGGGTCCAGCA
GGCTCTGCTGAAGATTCTCGAGGGGACGACGGCCTCGGTGCCGCCCCAGGGCGGGCGCAAGCACCCGCATCAGGAATTCATCCAGATTGA
CACCACCAACATTCTCTTCATCGTCGGGGGCGCCTTCGCCGGTCTGGAGAAGATTATCGAGGCGCGGATCGGCAAGAAGGGCATCGGTTT
CACCGCTACCTTGCACGGTAAGCGGGATCTCAACACTGCTGACATCTTCTCCCACGTCATGCCGGAAGACCTTTTGAAATACGGCATGAT
CCCAGAATTCGTCGGCCGCCTTCCGGTCATCACGACGGTGACAAGTCTCGATCGCGAGGCGCTCATTCGCATTCTCACCGAACCGAAGAA
CGCGCTGGTGCGGCAATATCAGCGGCTGTTCGAGTTGGATTCGGTCGACTTGGAATTCACGGACGACGCGCTCGAGGCCATCGCCGATCA
GGCCATTCTGCGCGGCACCGGGGCGCGCGGGCTGCGGGCCATCATGGAAGAAGTTCTTCTGTCTGTCATGTACGACATCCCGAGCCGAAC
GGACGTCGCCCGGGTCGTCATCACCCGCGACGTCGTGCTCAACAACGTGAACCCGACGCTGGTGCCGCGGGATTCGGTGGTCGCCAAACG
CGAGCGGCGCGAGAAGACCGCTTAG 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine27522 %
Guanine38330 %
Thyamine23519 %
Cytosine39131 %
A+T51040 %
G+C77461 %

Total Bases :   1284 bases

Microsatellites
SequencePosition LengthRepeats
GCAGCAGCA30733
GCGCGC110123

Microsatellite Map

GTGGCACGACTCGGCGACGGCGGTGACCTGCTCAAGTGTTCGTTCTGCGGCAAGAGCCAGAAGCAGGTGAAGAAGCTCATCGCGGGTCCC
GGCGTCTACATCTGCGACGAGTGCATTGATCTCTGCAATGAGATCATCGAAGAGGAGCTCTCCGAGTCGCACGAGCCGAAGTTCGACCAG
CTGCCCAAACCCCGGGAGATCTGCGAATTTCTCGATCAGTACGTTATCGGTCAAGAGACCGCAAAGAAGGCGTTGTCCGTCGCCGTCTAT
AACCACTACAAGCGGATCCAAGTCGGTGGTTCCAGCCGCAGCAGCAATGATTCGGTGGAACTTGCCAAATCGAACATCCTGCTCATCGGC
CCGACCGGCTGCGGCAAGACGTACCTCGCCCAGACCCTCGCCCGGATGCTCAATGTACCGTTCGCGATCGCGGATGCGACGGCGCTCACC
GAAGCCGGTTACGTGGGTGAGGATGTCGAGAACATCCTGCTCAAATTGATCCAGGCCGCCGATTACGACGTGAAGCGGGCCGAGACCGGC
ATCATCTACATCGACGAGATCGACAAAATCGCCCGCAAGAGTGAGAATCCGTCGATCACCCGCGACGTCTCTGGCGAGGGGGTCCAGCAG
GCTCTGCTGAAGATTCTCGAGGGGACGACGGCCTCGGTGCCGCCCCAGGGCGGGCGCAAGCACCCGCATCAGGAATTCATCCAGATTGAC
ACCACCAACATTCTCTTCATCGTCGGGGGCGCCTTCGCCGGTCTGGAGAAGATTATCGAGGCGCGGATCGGCAAGAAGGGCATCGGTTTC
ACCGCTACCTTGCACGGTAAGCGGGATCTCAACACTGCTGACATCTTCTCCCACGTCATGCCGGAAGACCTTTTGAAATACGGCATGATC
CCAGAATTCGTCGGCCGCCTTCCGGTCATCACGACGGTGACAAGTCTCGATCGCGAGGCGCTCATTCGCATTCTCACCGAACCGAAGAAC
GCGCTGGTGCGGCAATATCAGCGGCTGTTCGAGTTGGATTCGGTCGACTTGGAATTCACGGACGACGCGCTCGAGGCCATCGCCGATCAG
GCCATTCTGCGCGGCACCGGGGCGCGCGGGCTGCGGGCCATCATGGAAGAAGTTCTTCTGTCTGTCATGTACGACATCCCGAGCCGAACG
GACGTCGCCCGGGTCGTCATCACCCGCGACGTCGTGCTCAACAACGTGAACCCGACGCTGGTGCCGCGGGATTCGGTGGTCGCCAAACGC
GAGCGGCGCGAGAAGACCGCTTAG

Gene Information
Molecule Type genomic DNA
Bases 1284 Bases
Molecular Weight396714.6 Da
Coding Sequence CP000481.1:812359..813642
NCBI ReferenceABK52512
NotesKEGG: fra:Francci3_1207 ATP-dependent Clp protease;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Zf_C4 10 to 49 40 C4_type Zinc finger domain PF06689
NBD_2 111 to 310 200 Nucleotide binding domain 2 PF07724
Clp_C 316 to 407 92 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpX_ACCE1

Accession Number

HSP100_0021

Added on

2012-02-02

Updated On

2014-01-20