Help  Custom Search
 
ATPase AAA-2 domain protein. of Acidothermus cellulolyticus str. 11B

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATPase AAA-2 domain protein.

Synonymous Names

A0LWT1_ACIC1, Caseinolytic peptidase B, ClpB.

Taxon Information

Organism

Acidothermus cellulolyticus str. 11B

Organism ID

351607 [NCBI] [UNIPROT]

Lineage

Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae; Acidothermaceae; Acidothermus; Acidothermus cellulolyticus 11B

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MDGYRLTTKSQEALNQAVHAAAEAGHPHVEPAHLLMALLQQSDGTALPLLRAVGVNPVALQGDVREILDR LPRASGATVAPPGLDRPSIQVLNAAAKEAAELGDEYVSTEHLLVGLAREGGAVAALLRRHGATPENLLAA FERVRGHARVTSPDPESTYQALEKYGVDLTERARKGQLDPIIGRDTEIRRVIQVLSRRTKNNPVLIGEPG VGKTAIVEGLAQRIVAGDVPESLRDKRLIALDLGAMVAGAKYRGEFEERLKAVLNEIKESNGQVITFIDE LHTVVGAGAAEGAMDAGNMLKPMLARGELRMIGATTLDEYRERIEKDPALERRFQPVYVGEPSVEDTIGI LRGLKSRYEAHHKVQISDAALVAAATLSHRFISGRFLPDKAIDLVDEAASRLRMEIDSWPVEIDELRRTV DRLRMEELALAKEDDPASKERLERLRRELADKQEQLNALVARWEREKAALNRVGELKQRLDDLRSQAERA QRDGDFETASRLMYGEIPALERELAAAQSSGDGHGDTMVKEEVGPDDIAEVVSSWTGIPAGRLMEGEVGK LLRMEEELGRRVVGQEHAVRAVSDAVRRARSGIADPDRPTGSFLFLGPTGVGKTELAKALADFLFDDERA MVRIDMSEYSEKHSVARLIGAPPGYVGYEEGGQLTEAVRRRPYCVILLDEIEKAHVEVFDILLQVLDDGR LTDGQGRTVDFRNTILILTSNLGSNYLIDPTLDDEAKRESVMAVVRATFKPEFLNRLDEIIIFNALGTAE LAKIVDLQIERFQRRLTDRRITLEVTPAAREWLALNGYDAVYGARPLRRLIQTAIGDRLAKALLAGDVRD GDTVLVDLTADKTGLDLRVAVPSA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGACGGCTACCGGCTGACGACGAAGAGCCAAGAGGCGCTCAACCAGGCGGTGCACGCGGCCGCCGAAGCCGGCCATCCTCACGTAGA
ACCCGCACACCTTCTCATGGCTCTGCTCCAGCAGAGTGACGGCACGGCGCTTCCGCTTCTCCGGGCGGTCGGGGTGAATCCTGTTGCGCT
TCAGGGCGACGTCCGGGAGATTCTGGACCGGCTGCCGCGGGCGAGCGGGGCAACCGTGGCACCGCCCGGCTTGGATCGGCCGTCCATTCA
GGTGCTCAACGCTGCGGCGAAAGAGGCGGCCGAGCTCGGCGACGAGTACGTCTCCACCGAGCACCTGCTCGTCGGACTCGCCCGGGAAGG
CGGCGCCGTCGCCGCGCTGCTGCGGCGTCACGGCGCCACACCGGAGAATCTCCTCGCCGCATTCGAACGGGTCCGCGGCCACGCGCGGGT
CACCAGTCCCGACCCGGAGTCGACGTATCAAGCGCTCGAGAAATACGGCGTCGATCTGACCGAGCGGGCCCGCAAGGGCCAGCTCGACCC
GATCATCGGGCGCGACACGGAAATCCGCCGGGTTATTCAGGTGCTGTCTCGCCGCACCAAAAACAATCCGGTTCTCATTGGCGAGCCGGG
AGTCGGTAAGACGGCGATCGTGGAGGGGCTCGCGCAGCGGATCGTCGCGGGCGACGTGCCGGAATCCCTGCGGGACAAGCGCCTCATCGC
GCTTGACCTCGGTGCGATGGTCGCCGGAGCGAAGTACCGCGGTGAATTTGAGGAACGGCTCAAGGCCGTCCTCAACGAAATCAAGGAATC
CAACGGCCAGGTCATCACCTTCATCGACGAGCTGCACACCGTCGTCGGTGCGGGCGCGGCGGAAGGTGCGATGGACGCCGGCAACATGCT
GAAACCGATGTTGGCCCGCGGCGAACTCCGCATGATCGGCGCAACAACGCTCGATGAATACCGGGAGCGCATCGAAAAGGATCCTGCTTT
GGAGCGGCGGTTCCAGCCGGTGTACGTCGGTGAGCCGTCGGTCGAAGACACCATTGGCATTCTTCGCGGCCTGAAATCGCGGTACGAGGC
GCACCACAAGGTGCAAATTTCGGACGCCGCGTTGGTGGCCGCCGCGACGCTCTCCCACCGCTTCATCAGCGGTCGATTTCTCCCGGACAA
GGCGATAGACCTGGTCGATGAGGCCGCGAGCCGGCTGCGGATGGAAATCGACTCGTGGCCGGTCGAAATCGATGAGTTGCGGAGAACGGT
TGACCGGCTGCGCATGGAGGAGCTGGCGCTGGCCAAAGAGGACGATCCGGCGAGCAAGGAGCGGTTGGAGCGTCTGCGTCGCGAACTCGC
CGACAAGCAGGAACAGCTGAACGCCCTGGTCGCCCGCTGGGAGCGGGAGAAGGCCGCGCTCAACCGGGTCGGTGAGCTCAAGCAGCGTCT
GGACGACCTGCGCAGCCAGGCCGAGCGGGCCCAGCGCGACGGCGACTTCGAAACCGCCTCCCGATTGATGTACGGAGAAATTCCGGCGCT
CGAACGGGAACTCGCCGCAGCGCAGAGCAGCGGGGACGGCCACGGCGACACCATGGTCAAGGAGGAAGTCGGTCCCGACGACATCGCCGA
GGTGGTCTCCTCCTGGACCGGCATTCCCGCCGGGCGGCTCATGGAAGGAGAGGTCGGCAAGCTGCTGCGCATGGAAGAAGAGCTCGGACG
CCGGGTGGTCGGCCAAGAGCACGCCGTCCGGGCGGTGTCCGATGCGGTCCGGCGGGCCCGCTCCGGGATCGCCGATCCCGACCGGCCGAC
CGGTTCCTTCCTCTTCCTCGGGCCCACCGGCGTCGGCAAGACCGAGCTTGCCAAGGCGCTTGCCGATTTTCTCTTTGACGACGAGCGGGC
GATGGTCCGCATTGACATGAGCGAGTACTCCGAGAAGCACTCCGTCGCGCGGCTCATCGGCGCCCCGCCCGGTTACGTCGGCTACGAAGA
AGGTGGTCAGCTGACCGAGGCGGTCCGCCGCCGGCCGTACTGCGTCATTCTTCTCGATGAGATCGAGAAGGCGCACGTCGAAGTCTTCGA
CATCCTCCTGCAAGTCCTCGACGACGGCCGGCTGACCGACGGCCAAGGCCGCACCGTCGATTTCCGCAACACGATTCTCATTCTCACCTC
GAACCTCGGGTCGAATTACCTCATCGATCCGACCCTCGACGACGAGGCGAAGCGGGAATCCGTCATGGCCGTCGTCCGGGCCACGTTCAA
GCCGGAATTCCTCAACCGGCTTGACGAAATAATCATTTTCAACGCCCTCGGCACCGCGGAGCTCGCGAAAATCGTCGACCTGCAGATCGA
GCGGTTCCAGCGGCGATTGACCGACCGGCGGATCACGCTCGAGGTGACACCGGCCGCCCGGGAATGGCTTGCGCTCAACGGGTACGACGC
GGTGTACGGCGCACGCCCGCTTCGGCGGCTCATCCAGACCGCCATCGGCGACCGGCTCGCCAAGGCGCTCCTCGCCGGCGACGTCCGGGA
CGGCGACACCGTGCTCGTCGACCTGACCGCTGACAAGACCGGCCTGGATCTGCGGGTCGCGGTGCCGAGCGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine47719 %
Guanine87134 %
Thyamine39516 %
Cytosine85233 %
A+T87234 %
G+C172367 %

Total Bases :   2595 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG44023
CGCGCG193423
CCGCCGCCG200333
CGACGACGA219533

Microsatellite Map

ATGGACGGCTACCGGCTGACGACGAAGAGCCAAGAGGCGCTCAACCAGGCGGTGCACGCGGCCGCCGAAGCCGGCCATCCTCACGTAGAA
CCCGCACACCTTCTCATGGCTCTGCTCCAGCAGAGTGACGGCACGGCGCTTCCGCTTCTCCGGGCGGTCGGGGTGAATCCTGTTGCGCTT
CAGGGCGACGTCCGGGAGATTCTGGACCGGCTGCCGCGGGCGAGCGGGGCAACCGTGGCACCGCCCGGCTTGGATCGGCCGTCCATTCAG
GTGCTCAACGCTGCGGCGAAAGAGGCGGCCGAGCTCGGCGACGAGTACGTCTCCACCGAGCACCTGCTCGTCGGACTCGCCCGGGAAGGC
GGCGCCGTCGCCGCGCTGCTGCGGCGTCACGGCGCCACACCGGAGAATCTCCTCGCCGCATTCGAACGGGTCCGCGGCCACGCGCGGGTC
ACCAGTCCCGACCCGGAGTCGACGTATCAAGCGCTCGAGAAATACGGCGTCGATCTGACCGAGCGGGCCCGCAAGGGCCAGCTCGACCCG
ATCATCGGGCGCGACACGGAAATCCGCCGGGTTATTCAGGTGCTGTCTCGCCGCACCAAAAACAATCCGGTTCTCATTGGCGAGCCGGGA
GTCGGTAAGACGGCGATCGTGGAGGGGCTCGCGCAGCGGATCGTCGCGGGCGACGTGCCGGAATCCCTGCGGGACAAGCGCCTCATCGCG
CTTGACCTCGGTGCGATGGTCGCCGGAGCGAAGTACCGCGGTGAATTTGAGGAACGGCTCAAGGCCGTCCTCAACGAAATCAAGGAATCC
AACGGCCAGGTCATCACCTTCATCGACGAGCTGCACACCGTCGTCGGTGCGGGCGCGGCGGAAGGTGCGATGGACGCCGGCAACATGCTG
AAACCGATGTTGGCCCGCGGCGAACTCCGCATGATCGGCGCAACAACGCTCGATGAATACCGGGAGCGCATCGAAAAGGATCCTGCTTTG
GAGCGGCGGTTCCAGCCGGTGTACGTCGGTGAGCCGTCGGTCGAAGACACCATTGGCATTCTTCGCGGCCTGAAATCGCGGTACGAGGCG
CACCACAAGGTGCAAATTTCGGACGCCGCGTTGGTGGCCGCCGCGACGCTCTCCCACCGCTTCATCAGCGGTCGATTTCTCCCGGACAAG
GCGATAGACCTGGTCGATGAGGCCGCGAGCCGGCTGCGGATGGAAATCGACTCGTGGCCGGTCGAAATCGATGAGTTGCGGAGAACGGTT
GACCGGCTGCGCATGGAGGAGCTGGCGCTGGCCAAAGAGGACGATCCGGCGAGCAAGGAGCGGTTGGAGCGTCTGCGTCGCGAACTCGCC
GACAAGCAGGAACAGCTGAACGCCCTGGTCGCCCGCTGGGAGCGGGAGAAGGCCGCGCTCAACCGGGTCGGTGAGCTCAAGCAGCGTCTG
GACGACCTGCGCAGCCAGGCCGAGCGGGCCCAGCGCGACGGCGACTTCGAAACCGCCTCCCGATTGATGTACGGAGAAATTCCGGCGCTC
GAACGGGAACTCGCCGCAGCGCAGAGCAGCGGGGACGGCCACGGCGACACCATGGTCAAGGAGGAAGTCGGTCCCGACGACATCGCCGAG
GTGGTCTCCTCCTGGACCGGCATTCCCGCCGGGCGGCTCATGGAAGGAGAGGTCGGCAAGCTGCTGCGCATGGAAGAAGAGCTCGGACGC
CGGGTGGTCGGCCAAGAGCACGCCGTCCGGGCGGTGTCCGATGCGGTCCGGCGGGCCCGCTCCGGGATCGCCGATCCCGACCGGCCGACC
GGTTCCTTCCTCTTCCTCGGGCCCACCGGCGTCGGCAAGACCGAGCTTGCCAAGGCGCTTGCCGATTTTCTCTTTGACGACGAGCGGGCG
ATGGTCCGCATTGACATGAGCGAGTACTCCGAGAAGCACTCCGTCGCGCGGCTCATCGGCGCCCCGCCCGGTTACGTCGGCTACGAAGAA
GGTGGTCAGCTGACCGAGGCGGTCCGCCGCCGGCCGTACTGCGTCATTCTTCTCGATGAGATCGAGAAGGCGCACGTCGAAGTCTTCGAC
ATCCTCCTGCAAGTCCTCGACGACGGCCGGCTGACCGACGGCCAAGGCCGCACCGTCGATTTCCGCAACACGATTCTCATTCTCACCTCG
AACCTCGGGTCGAATTACCTCATCGATCCGACCCTCGACGACGAGGCGAAGCGGGAATCCGTCATGGCCGTCGTCCGGGCCACGTTCAAG
CCGGAATTCCTCAACCGGCTTGACGAAATAATCATTTTCAACGCCCTCGGCACCGCGGAGCTCGCGAAAATCGTCGACCTGCAGATCGAG
CGGTTCCAGCGGCGATTGACCGACCGGCGGATCACGCTCGAGGTGACACCGGCCGCCCGGGAATGGCTTGCGCTCAACGGGTACGACGCG
GTGTACGGCGCACGCCCGCTTCGGCGGCTCATCCAGACCGCCATCGGCGACCGGCTCGCCAAGGCGCTCCTCGCCGGCGACGTCCGGGAC
GGCGACACCGTGCTCGTCGACCTGACCGCTGACAAGACCGGCCTGGATCTGCGGGTCGCGGTGCCGAGCGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 2595 Bases
Molecular Weight802621.48 Da
Coding Sequence CP000481.1:2398219..2400813
NCBI ReferenceABK53891
NotesPFAM: AAA ATPase; central domain protein; Clp N

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 17 to 69 53 Clp amino terminal domain PF02861
N Domain 95 to 146 52 Clp amino terminal domain PF02861
NBD_1 203 to 340 138 Nucleotide binding domain 1 PF00004
M Domain 425 to 498 74 Coiled coil Middle domain Manually identified
NBD_2 598 to 760 163 Nucleotide binding domain 2 PF07724
Clp_C 766 to 855 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACCE1

Accession Number

HSP100_0019

Added on

2012-02-02

Updated On

2014-01-20