Help  Custom Search
 
heat shock protein HslVU, ATPase subunit HslU. of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein HslVU, ATPase subunit HslU.

Synonymous Names

C1F2J7_ACIC5, Heat Shock like U.

Gene names

Gene Name

hslU

Gene Locus Tag

ACP_2657

Gene Identifier

7700942

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpY/HslU)

SEQUENCE INFORMATION

Sequence
MAIYLPGTAEDQELALDELTPREIVGELDKYVVGQKAAKRAVAIALRNRMRRQKLTPDLADEIMPKNIIM IGPTGVGKTEIARRLAKLTNSPFLKVEASKFTEVGYVGRDVESMVRDLVEIAIDMVREEKLEEVEDKAEL NAEERLLDLLLPPPATQTPAAAPAGAGETPDAHGAIILPPPAASATQESQQRTREKLRQQFREGKLDDRM VELDVRERGAPSFEIISNQGVEEMDINLKDVLPSIFGQRTKKRKMKVAEAFEYLVQEEESRLIDMDQVTR AAVERVETSGIVFLDEIDKIAGREGGHGPDVSREGVQRDILPIVEGTTVNTRYGMVRTDYILFIAAGAFH VSKPSDLIPELQGRFPIRVELQSLTVEDFIRILTEPKSSLVKQSTALLETEGLKLEFTPEAIAEMAQFAF SVNETTENIGARRLHTIMEKVLDDISFLAPDLIKHGKGKSEAGVVDLAAAANGHAEMAPIAPLPVIERET PGGTELVAVVDPEYVKQMVASIVKNQDLSRYIL

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCCATCTATCTACCCGGCACGGCCGAAGATCAGGAGCTCGCGCTCGATGAGCTCACCCCCCGCGAAATCGTCGGCGAGCTCGACAA
GTATGTCGTCGGCCAGAAGGCCGCCAAGCGCGCCGTCGCCATCGCCCTGCGCAACCGCATGCGCCGCCAAAAGCTCACGCCCGATCTCGC
CGATGAGATCATGCCCAAAAACATCATCATGATCGGCCCCACCGGCGTGGGCAAAACCGAAATCGCCCGCCGCCTGGCCAAGCTCACCAA
CTCGCCCTTCCTTAAGGTCGAGGCCTCCAAGTTTACTGAGGTGGGCTACGTGGGCCGCGATGTCGAGTCCATGGTGCGCGACCTCGTCGA
GATCGCCATCGACATGGTGCGCGAAGAAAAGCTCGAAGAGGTCGAAGACAAGGCCGAGCTCAACGCCGAGGAGCGACTCCTCGATCTCCT
CCTGCCGCCGCCCGCCACACAGACCCCCGCCGCCGCGCCCGCAGGCGCCGGCGAAACCCCGGACGCACACGGAGCCATCATCCTCCCGCC
GCCCGCCGCCTCGGCCACGCAGGAGTCACAGCAGCGCACCCGCGAAAAGCTCCGCCAGCAATTCCGCGAGGGCAAGCTCGATGACCGCAT
GGTCGAGCTGGACGTGCGCGAGCGCGGTGCGCCGTCCTTTGAAATCATCTCCAACCAGGGCGTCGAAGAGATGGACATCAATCTCAAGGA
CGTGTTGCCCAGCATCTTTGGCCAGCGCACCAAAAAGCGCAAAATGAAGGTCGCCGAGGCCTTCGAATATCTGGTGCAGGAAGAGGAAAG
CCGCCTCATTGACATGGATCAGGTCACCCGCGCCGCCGTCGAGCGCGTCGAGACCTCCGGCATCGTCTTCCTCGACGAAATCGACAAGAT
CGCCGGTCGCGAAGGCGGCCACGGCCCCGACGTCTCGCGCGAGGGCGTGCAGCGCGACATCCTGCCCATCGTCGAAGGCACCACCGTCAA
CACCCGCTACGGCATGGTGCGCACCGACTACATTCTGTTCATCGCCGCCGGAGCCTTCCACGTCTCCAAGCCCAGCGACCTCATCCCTGA
GCTGCAGGGCCGCTTCCCCATTCGCGTCGAGCTGCAGTCGCTCACCGTCGAGGACTTCATCCGCATCCTCACCGAGCCCAAGTCCTCCCT
CGTCAAGCAGTCCACCGCGCTGCTTGAGACCGAAGGCCTCAAACTCGAATTCACGCCCGAGGCCATCGCCGAGATGGCGCAGTTTGCCTT
CAGCGTCAACGAGACGACGGAGAACATCGGCGCGCGCCGCCTGCACACCATCATGGAGAAGGTGCTCGACGACATCAGCTTCCTAGCCCC
TGACCTCATCAAGCACGGCAAGGGCAAGTCCGAGGCCGGAGTCGTCGATCTCGCCGCCGCCGCCAACGGCCACGCCGAGATGGCGCCCAT
CGCGCCCCTGCCCGTCATCGAGCGCGAAACCCCCGGCGGCACCGAGTTGGTCGCCGTCGTCGATCCCGAATACGTCAAGCAGATGGTCGC
CTCGATCGTCAAAAATCAGGACCTCTCGCGCTACATCCTCTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine32921 %
Guanine43328 %
Thyamine23115 %
Cytosine57937 %
A+T56036 %
G+C101265 %

Total Bases :   1572 bases

Microsatellites
SequencePosition LengthRepeats
CCCCCC5823
GCGCGC11623
CATCATCAT20033
GCCGCCGCC45233
CACACA46423
CCGCCGCCG47533
CGCGCG93423
GCGCGCGC128824
CGCCGCCGCCGC140034

Microsatellite Map

ATGGCCATCTATCTACCCGGCACGGCCGAAGATCAGGAGCTCGCGCTCGATGAGCTCACCCCCCGCGAAATCGTCGGCGAGCTCGACAAG
TATGTCGTCGGCCAGAAGGCCGCCAAGCGCGCCGTCGCCATCGCCCTGCGCAACCGCATGCGCCGCCAAAAGCTCACGCCCGATCTCGCC
GATGAGATCATGCCCAAAAACATCATCATGATCGGCCCCACCGGCGTGGGCAAAACCGAAATCGCCCGCCGCCTGGCCAAGCTCACCAAC
TCGCCCTTCCTTAAGGTCGAGGCCTCCAAGTTTACTGAGGTGGGCTACGTGGGCCGCGATGTCGAGTCCATGGTGCGCGACCTCGTCGAG
ATCGCCATCGACATGGTGCGCGAAGAAAAGCTCGAAGAGGTCGAAGACAAGGCCGAGCTCAACGCCGAGGAGCGACTCCTCGATCTCCTC
CTGCCGCCGCCCGCCACACAGACCCCCGCCGCCGCGCCCGCAGGCGCCGGCGAAACCCCGGACGCACACGGAGCCATCATCCTCCCGCCG
CCCGCCGCCTCGGCCACGCAGGAGTCACAGCAGCGCACCCGCGAAAAGCTCCGCCAGCAATTCCGCGAGGGCAAGCTCGATGACCGCATG
GTCGAGCTGGACGTGCGCGAGCGCGGTGCGCCGTCCTTTGAAATCATCTCCAACCAGGGCGTCGAAGAGATGGACATCAATCTCAAGGAC
GTGTTGCCCAGCATCTTTGGCCAGCGCACCAAAAAGCGCAAAATGAAGGTCGCCGAGGCCTTCGAATATCTGGTGCAGGAAGAGGAAAGC
CGCCTCATTGACATGGATCAGGTCACCCGCGCCGCCGTCGAGCGCGTCGAGACCTCCGGCATCGTCTTCCTCGACGAAATCGACAAGATC
GCCGGTCGCGAAGGCGGCCACGGCCCCGACGTCTCGCGCGAGGGCGTGCAGCGCGACATCCTGCCCATCGTCGAAGGCACCACCGTCAAC
ACCCGCTACGGCATGGTGCGCACCGACTACATTCTGTTCATCGCCGCCGGAGCCTTCCACGTCTCCAAGCCCAGCGACCTCATCCCTGAG
CTGCAGGGCCGCTTCCCCATTCGCGTCGAGCTGCAGTCGCTCACCGTCGAGGACTTCATCCGCATCCTCACCGAGCCCAAGTCCTCCCTC
GTCAAGCAGTCCACCGCGCTGCTTGAGACCGAAGGCCTCAAACTCGAATTCACGCCCGAGGCCATCGCCGAGATGGCGCAGTTTGCCTTC
AGCGTCAACGAGACGACGGAGAACATCGGCGCGCGCCGCCTGCACACCATCATGGAGAAGGTGCTCGACGACATCAGCTTCCTAGCCCCT
GACCTCATCAAGCACGGCAAGGGCAAGTCCGAGGCCGGAGTCGTCGATCTCGCCGCCGCCGCCAACGGCCACGCCGAGATGGCGCCCATC
GCGCCCCTGCCCGTCATCGAGCGCGAAACCCCCGGCGGCACCGAGTTGGTCGCCGTCGTCGATCCCGAATACGTCAAGCAGATGGTCGCC
TCGATCGTCAAAAATCAGGACCTCTCGCGCTACATCCTCTAA

Gene Information
Molecule Type genomic DNA
Bases 1572 Bases
Molecular Weight483237.48 Da
Coding Sequence CP001472.1:3072413..3073984
NCBI ReferenceACO32421
Notesidentified by similarity to SP:P39778; match to

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
AAA_5 67 to 113 47 AAA domain (dynein-related subfamily) PF07728
NBD_2 218 to 368 151 Nucleotide binding domain 2 PF07724
Clp_C 374 to 465 92 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HslU_ACCA1

Accession Number

HSP100_0018

Added on

2012-02-02

Updated On

2014-01-20