Help  Custom Search
 
ATP-dependent Clp protease, ATP-binding subunit ClpX. of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent Clp protease, ATP-binding subunit ClpX.

Synonymous Names

C1F6W3_ACIC5, Caseinolytic peptidase C, ClpC.

Gene names

Gene Name

clpX

Gene Locus Tag

ACP_3432

Gene Identifier

7700881

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpX-Caseinolytic peptidase X)

SEQUENCE INFORMATION

Sequence
MKTRTGSDDSLRCSFCHKSQDAVAKLISSPSDYPRAYICDECVAVCNSILEDDRAEAPAGAAPTQLPKPL EVKAFLDEYVIGQEQTKKKLAVAVYNHYKRIQMNRTRGNDVELAKSNILLVGPTGSGKTLLAHTLAKMLD VPFAIVDATTLTEAGYVGEDVENIILKLLQAADGDVARAQTGIIYIDEIDKIGRKDENPSITRDVSGEGV QQALLKILEGTVANVPPQGGRKHPHQEFTPVDTTNILFICGGAFVGLERVVGRRVGKKALGFKAIAEKDQ QENGQTTRTQRDTELLRMAEPQDLIRYGLIPEFVGRLPVIGILDELDEAALVEILTKPRNAILKQYQKLF EFEGVNLVFSEEAAHAIALEALDRKVGARGLRMILEELMLDLMYHLPSNKRVSDLVIDAEMVKKRDLSLS LLDKAG

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAAGACGCGCACGGGTTCGGACGACTCGCTCCGCTGTTCGTTCTGCCACAAGTCTCAGGACGCTGTGGCCAAACTCATTTCATCCCC
GAGCGATTATCCCCGCGCCTATATCTGCGACGAGTGCGTGGCGGTATGCAATTCCATCCTCGAGGATGACCGTGCCGAGGCCCCTGCGGG
CGCTGCTCCCACGCAGTTGCCCAAGCCGCTCGAAGTGAAGGCGTTTCTGGACGAGTACGTCATCGGCCAGGAGCAGACCAAGAAGAAGCT
GGCCGTCGCCGTTTACAACCACTACAAGCGCATCCAGATGAACCGCACGCGCGGCAATGATGTGGAGCTGGCGAAGTCAAACATCCTTCT
GGTAGGCCCCACAGGCAGCGGCAAGACTCTGCTGGCGCATACGCTGGCCAAGATGCTCGACGTGCCGTTTGCCATTGTGGACGCCACCAC
GCTCACGGAAGCCGGGTATGTGGGCGAGGACGTCGAGAACATCATCCTGAAGCTGCTGCAAGCCGCCGACGGCGATGTGGCGCGCGCGCA
GACCGGCATTATCTATATTGATGAGATCGACAAGATCGGCCGCAAGGACGAGAACCCCTCCATCACGCGCGACGTGTCGGGCGAGGGCGT
GCAACAGGCCCTGCTGAAGATTCTGGAAGGCACGGTGGCGAATGTGCCCCCGCAGGGCGGCCGCAAGCACCCGCACCAGGAGTTCACACC
GGTGGACACCACCAATATTCTCTTCATCTGCGGCGGCGCCTTCGTCGGGCTGGAGCGAGTGGTGGGACGCCGTGTCGGCAAGAAGGCGCT
CGGCTTCAAGGCCATCGCCGAAAAAGACCAGCAGGAGAACGGCCAGACGACCCGCACGCAGCGCGATACCGAGCTGCTGCGCATGGCCGA
GCCGCAGGATCTGATCCGCTACGGCCTGATTCCTGAGTTTGTCGGCCGTCTGCCGGTCATCGGCATTCTCGATGAGCTGGATGAGGCGGC
GCTGGTGGAAATCCTGACCAAGCCCCGCAACGCCATTCTGAAGCAGTATCAGAAGCTCTTTGAGTTTGAGGGCGTCAATCTGGTCTTCTC
AGAGGAAGCGGCTCACGCCATCGCGCTCGAGGCGCTCGACCGCAAGGTGGGCGCGCGCGGTCTGCGCATGATTCTGGAGGAGTTGATGCT
TGACCTGATGTATCACCTGCCCAGCAACAAGCGGGTGAGCGATCTGGTCATCGACGCCGAAATGGTCAAGAAGCGCGATCTTTCGCTCAG
TCTTCTCGATAAGGCCGGTTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine26521 %
Guanine40032 %
Thyamine23018 %
Cytosine38631 %
A+T49539 %
G+C78662 %

Total Bases :   1281 bases

Microsatellites
SequencePosition LengthRepeats
AAGAAGAAG25833
CGCGCG31623
GCGCGCGCGC52825
CGCGCG60423
GCGGCGGCG74833
GCGCGCGC112924

Microsatellite Map

ATGAAGACGCGCACGGGTTCGGACGACTCGCTCCGCTGTTCGTTCTGCCACAAGTCTCAGGACGCTGTGGCCAAACTCATTTCATCCCCG
AGCGATTATCCCCGCGCCTATATCTGCGACGAGTGCGTGGCGGTATGCAATTCCATCCTCGAGGATGACCGTGCCGAGGCCCCTGCGGGC
GCTGCTCCCACGCAGTTGCCCAAGCCGCTCGAAGTGAAGGCGTTTCTGGACGAGTACGTCATCGGCCAGGAGCAGACCAAGAAGAAGCTG
GCCGTCGCCGTTTACAACCACTACAAGCGCATCCAGATGAACCGCACGCGCGGCAATGATGTGGAGCTGGCGAAGTCAAACATCCTTCTG
GTAGGCCCCACAGGCAGCGGCAAGACTCTGCTGGCGCATACGCTGGCCAAGATGCTCGACGTGCCGTTTGCCATTGTGGACGCCACCACG
CTCACGGAAGCCGGGTATGTGGGCGAGGACGTCGAGAACATCATCCTGAAGCTGCTGCAAGCCGCCGACGGCGATGTGGCGCGCGCGCAG
ACCGGCATTATCTATATTGATGAGATCGACAAGATCGGCCGCAAGGACGAGAACCCCTCCATCACGCGCGACGTGTCGGGCGAGGGCGTG
CAACAGGCCCTGCTGAAGATTCTGGAAGGCACGGTGGCGAATGTGCCCCCGCAGGGCGGCCGCAAGCACCCGCACCAGGAGTTCACACCG
GTGGACACCACCAATATTCTCTTCATCTGCGGCGGCGCCTTCGTCGGGCTGGAGCGAGTGGTGGGACGCCGTGTCGGCAAGAAGGCGCTC
GGCTTCAAGGCCATCGCCGAAAAAGACCAGCAGGAGAACGGCCAGACGACCCGCACGCAGCGCGATACCGAGCTGCTGCGCATGGCCGAG
CCGCAGGATCTGATCCGCTACGGCCTGATTCCTGAGTTTGTCGGCCGTCTGCCGGTCATCGGCATTCTCGATGAGCTGGATGAGGCGGCG
CTGGTGGAAATCCTGACCAAGCCCCGCAACGCCATTCTGAAGCAGTATCAGAAGCTCTTTGAGTTTGAGGGCGTCAATCTGGTCTTCTCA
GAGGAAGCGGCTCACGCCATCGCGCTCGAGGCGCTCGACCGCAAGGTGGGCGCGCGCGGTCTGCGCATGATTCTGGAGGAGTTGATGCTT
GACCTGATGTATCACCTGCCCAGCAACAAGCGGGTGAGCGATCTGGTCATCGACGCCGAAATGGTCAAGAAGCGCGATCTTTCGCTCAGT
CTTCTCGATAAGGCCGGTTGA

Gene Information
Molecule Type genomic DNA
Bases 1281 Bases
Molecular Weight396212.17 Da
Coding Sequence complement(CP001472.1:3980616..3981896)
NCBI ReferenceACO31650
Notesidentified by match to protein family HMM PF00004;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Zf_C4 10 to 53 44 C4_type Zinc finger domain PF06689
NBD_2 113 to 320 208 Nucleotide binding domain 2 PF07724
Clp_C 326 to 417 92 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpX_ACCA1

Accession Number

HSP100_0017

Added on

2012-02-02

Updated On

2014-01-20