Help  Custom Search
 
ATP-dependent chaperone protein ClpB. of Acidobacterium capsulatum str. ATCC 51196

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent chaperone protein ClpB.

Synonymous Names

C1F1A3_ACIC5, Caseinolytic peptidase B, ClpB.

Gene names

Gene Name

clpB

Gene Locus Tag

ACP_2407

Gene Identifier

7698866

Taxon Information

Organism

Acidobacterium capsulatum str. ATCC 51196

Organism ID

240015 [NCBI] [UNIPROT]

Lineage

Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae; Acidobacterium; Acidobacterium capsulatum ATCC 51196

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MAIRWDKFTVKSQEAVQAASGIASEHGNPELLTLHLLAALLADQESIVVPVLEKVGVPTAQLRTKVEEAI AKLPKVSGASAQPGIAATLNKVFDQAFKEAENFKDDYVSTEHLLLAMAAQKNDGAQLLLASVGATYDAIL KSLSSVRGSQRVTDQNPEGKFQALEKYAKDLTELARRGKLDPVIGRDEEIRRVVQVLSRRTKNNPVLIGE PGVGKTAIVEGLARRIVHGDVPEILREKRVISLDLGSMLAGAKFRGEFEDRLKAVLKEIEESNGQIILFI DELHTLVGAGAAEGAIDASNMLKPALARGELRAIGATTLNEYRKYIEKDAALERRFQIVFVGEPNVEDTI AILRGLKERYEAHHKVRIKDAAIVSAATLSHRYISDRFLPDKAIDLVDEAAASLAIQIGSVPTEIDQLER EATSLEIERTALKRETDQNSKDRLEVVERELAALKEQATGLRARWQKEREAITQLSELKNRVEALRFEAD EQTRRGNLERAAQIQYGELPRLEAEVQKLNAQQEGAENAQRMLKEEVDEEDIARVVSKWTGIPVAKMLEG EVQKLVQMEERLRDRVVGQDEALSTVANAIRRSRAGLSDPKRPIGSFIFLGPTGVGKTETARALAEFLFD DEQAMIRIDMSEYMEKHAVARLIGAPPGYVGYDEGGQLTEAVRRRPYSVVLFDEIEKAHPDVFNVLLQVL DDGRLTDSKGRTVDFKNTVLIMTSNLGAQALHAEALQDEAAFEQAREQVMEVLRQSFRPEFLNRVDDIVI FRPLGEAQLVHIVDLRLKDLEQLLKERHITIELTDAARHQLFLSGYDRAYGARPLKRAMQRLIQDPLAMR ILDGEVLHGDHVRIDADPLKNQLSFEVTGREAVK

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCGATTCGTTGGGACAAATTTACGGTGAAGTCGCAGGAGGCGGTGCAGGCGGCGAGTGGGATTGCGAGCGAGCATGGGAATCCTGA
GCTGCTGACGCTGCACTTGCTGGCCGCACTGCTGGCCGATCAGGAGAGCATCGTGGTGCCGGTGCTCGAGAAGGTGGGCGTGCCCACGGC
GCAGTTGCGCACCAAGGTGGAGGAAGCGATTGCGAAGCTGCCGAAGGTGAGCGGAGCCTCGGCGCAGCCTGGGATTGCGGCGACGCTGAA
CAAGGTGTTTGACCAGGCCTTCAAGGAAGCGGAGAACTTCAAGGACGATTACGTCTCGACGGAACATCTTTTATTGGCGATGGCCGCGCA
AAAGAACGATGGCGCGCAGTTGCTGCTGGCCTCGGTGGGCGCGACGTATGACGCGATATTAAAGAGCCTGAGCAGCGTGCGCGGTTCGCA
GCGGGTGACGGACCAGAATCCGGAAGGCAAATTTCAGGCGCTGGAGAAGTATGCGAAGGACCTGACGGAACTGGCGCGGCGCGGCAAGCT
GGACCCGGTGATTGGGCGCGACGAGGAGATTCGCCGCGTGGTGCAGGTGCTGTCGCGGCGGACGAAGAACAATCCGGTGCTGATTGGCGA
GCCGGGCGTGGGCAAGACGGCGATTGTGGAGGGGCTGGCGCGGCGCATTGTGCATGGCGACGTGCCGGAGATTTTGCGCGAGAAGCGAGT
GATTTCGCTTGACCTTGGCTCGATGCTGGCCGGGGCGAAGTTTCGCGGCGAGTTTGAAGACCGCCTGAAGGCTGTGCTGAAAGAGATTGA
GGAGTCGAATGGGCAGATCATTCTGTTCATCGACGAGCTGCACACGCTGGTGGGCGCGGGCGCGGCAGAGGGCGCGATTGATGCGTCGAA
CATGCTGAAGCCGGCGCTGGCGCGCGGCGAGCTGCGCGCGATTGGCGCGACGACGCTGAACGAGTATCGCAAATACATTGAGAAGGACGC
GGCGCTGGAGCGGCGCTTTCAGATTGTGTTTGTGGGCGAGCCGAATGTCGAGGACACGATTGCGATTTTGCGCGGGCTGAAGGAGCGCTA
TGAGGCGCATCACAAGGTGCGCATCAAGGATGCGGCGATTGTGTCGGCCGCGACATTGTCGCATCGCTATATCTCGGACCGGTTTTTGCC
GGACAAGGCGATTGACCTGGTGGACGAGGCGGCGGCTTCGCTGGCGATTCAGATAGGATCGGTGCCCACGGAGATAGATCAACTGGAGCG
CGAGGCGACGTCGCTTGAGATTGAGCGGACGGCGTTGAAGCGCGAGACGGACCAGAATTCCAAAGACCGGCTGGAAGTGGTGGAGCGCGA
ATTGGCCGCATTGAAGGAGCAGGCGACCGGGCTGCGGGCGCGCTGGCAGAAGGAGCGCGAGGCAATCACGCAACTGAGCGAGCTGAAGAA
CCGTGTGGAGGCGCTGCGCTTTGAGGCCGATGAGCAGACGCGGCGCGGAAACCTGGAGCGCGCCGCGCAGATTCAGTACGGCGAGTTGCC
GCGGCTGGAGGCCGAGGTGCAGAAGCTGAACGCGCAGCAGGAGGGCGCGGAGAATGCGCAGCGCATGCTGAAAGAAGAAGTGGATGAGGA
AGACATTGCGCGCGTGGTGAGCAAGTGGACCGGGATTCCCGTGGCCAAGATGCTTGAGGGCGAAGTGCAGAAGCTGGTGCAGATGGAGGA
GCGGCTGCGCGACCGGGTCGTGGGGCAGGATGAGGCGCTGAGCACGGTGGCGAATGCGATCCGTCGTTCGCGCGCGGGGCTGAGCGACCC
GAAGCGGCCGATTGGCTCGTTTATTTTCCTGGGACCCACGGGCGTCGGCAAGACGGAGACGGCGCGGGCGCTGGCCGAGTTCCTGTTTGA
TGACGAGCAGGCGATGATTCGCATCGACATGAGCGAGTACATGGAGAAGCATGCGGTGGCGCGTTTGATTGGCGCGCCTCCGGGCTATGT
GGGCTATGACGAGGGCGGCCAGTTGACGGAGGCCGTGCGGCGGCGGCCTTACTCGGTGGTGCTGTTTGACGAGATCGAGAAGGCGCATCC
GGATGTGTTCAACGTGCTGCTGCAGGTGCTGGACGACGGGCGGCTGACGGACTCGAAGGGGCGCACGGTGGACTTCAAGAACACGGTGCT
CATCATGACCTCAAACCTGGGCGCGCAGGCGCTGCATGCCGAGGCGTTGCAGGATGAAGCGGCCTTTGAGCAGGCGCGCGAGCAGGTGAT
GGAGGTGCTGCGGCAGAGCTTTAGGCCGGAGTTTTTGAACCGCGTGGATGACATTGTGATCTTCCGTCCGCTGGGCGAAGCGCAACTGGT
GCATATTGTGGATCTGCGGCTCAAGGATCTGGAGCAGTTGCTGAAGGAGCGTCACATCACGATTGAGCTGACGGATGCGGCGCGGCATCA
GCTCTTCCTGAGTGGATATGATCGCGCGTACGGTGCGCGTCCGTTGAAGCGTGCCATGCAGCGGTTGATTCAAGATCCGCTGGCGATGCG
GATTCTGGATGGAGAGGTGCTGCATGGGGATCATGTGCGGATTGATGCTGATCCGCTCAAGAACCAGTTGAGCTTTGAGGTGACGGGAAG
AGAGGCGGTGAAGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine52220 %
Guanine102039 %
Thyamine47018 %
Cytosine61324 %
A+T99238 %
G+C163363 %

Total Bases :   2625 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC37023
GCGCGC91823
GCGCGC93223
GGCGGCGGC119633
GCGCGC138623
GCGCGC149623
AAGAAGAAG160033
GCGCGC162623
CGCGCGCG177724
GCGCGC196023
GCGGCGGCG201533
TGCTGCTGC208333
GCGCGC217923
GCGCGC223223
CGCGCG245123
AGAGAG260723

Microsatellite Map

ATGGCGATTCGTTGGGACAAATTTACGGTGAAGTCGCAGGAGGCGGTGCAGGCGGCGAGTGGGATTGCGAGCGAGCATGGGAATCCTGAG
CTGCTGACGCTGCACTTGCTGGCCGCACTGCTGGCCGATCAGGAGAGCATCGTGGTGCCGGTGCTCGAGAAGGTGGGCGTGCCCACGGCG
CAGTTGCGCACCAAGGTGGAGGAAGCGATTGCGAAGCTGCCGAAGGTGAGCGGAGCCTCGGCGCAGCCTGGGATTGCGGCGACGCTGAAC
AAGGTGTTTGACCAGGCCTTCAAGGAAGCGGAGAACTTCAAGGACGATTACGTCTCGACGGAACATCTTTTATTGGCGATGGCCGCGCAA
AAGAACGATGGCGCGCAGTTGCTGCTGGCCTCGGTGGGCGCGACGTATGACGCGATATTAAAGAGCCTGAGCAGCGTGCGCGGTTCGCAG
CGGGTGACGGACCAGAATCCGGAAGGCAAATTTCAGGCGCTGGAGAAGTATGCGAAGGACCTGACGGAACTGGCGCGGCGCGGCAAGCTG
GACCCGGTGATTGGGCGCGACGAGGAGATTCGCCGCGTGGTGCAGGTGCTGTCGCGGCGGACGAAGAACAATCCGGTGCTGATTGGCGAG
CCGGGCGTGGGCAAGACGGCGATTGTGGAGGGGCTGGCGCGGCGCATTGTGCATGGCGACGTGCCGGAGATTTTGCGCGAGAAGCGAGTG
ATTTCGCTTGACCTTGGCTCGATGCTGGCCGGGGCGAAGTTTCGCGGCGAGTTTGAAGACCGCCTGAAGGCTGTGCTGAAAGAGATTGAG
GAGTCGAATGGGCAGATCATTCTGTTCATCGACGAGCTGCACACGCTGGTGGGCGCGGGCGCGGCAGAGGGCGCGATTGATGCGTCGAAC
ATGCTGAAGCCGGCGCTGGCGCGCGGCGAGCTGCGCGCGATTGGCGCGACGACGCTGAACGAGTATCGCAAATACATTGAGAAGGACGCG
GCGCTGGAGCGGCGCTTTCAGATTGTGTTTGTGGGCGAGCCGAATGTCGAGGACACGATTGCGATTTTGCGCGGGCTGAAGGAGCGCTAT
GAGGCGCATCACAAGGTGCGCATCAAGGATGCGGCGATTGTGTCGGCCGCGACATTGTCGCATCGCTATATCTCGGACCGGTTTTTGCCG
GACAAGGCGATTGACCTGGTGGACGAGGCGGCGGCTTCGCTGGCGATTCAGATAGGATCGGTGCCCACGGAGATAGATCAACTGGAGCGC
GAGGCGACGTCGCTTGAGATTGAGCGGACGGCGTTGAAGCGCGAGACGGACCAGAATTCCAAAGACCGGCTGGAAGTGGTGGAGCGCGAA
TTGGCCGCATTGAAGGAGCAGGCGACCGGGCTGCGGGCGCGCTGGCAGAAGGAGCGCGAGGCAATCACGCAACTGAGCGAGCTGAAGAAC
CGTGTGGAGGCGCTGCGCTTTGAGGCCGATGAGCAGACGCGGCGCGGAAACCTGGAGCGCGCCGCGCAGATTCAGTACGGCGAGTTGCCG
CGGCTGGAGGCCGAGGTGCAGAAGCTGAACGCGCAGCAGGAGGGCGCGGAGAATGCGCAGCGCATGCTGAAAGAAGAAGTGGATGAGGAA
GACATTGCGCGCGTGGTGAGCAAGTGGACCGGGATTCCCGTGGCCAAGATGCTTGAGGGCGAAGTGCAGAAGCTGGTGCAGATGGAGGAG
CGGCTGCGCGACCGGGTCGTGGGGCAGGATGAGGCGCTGAGCACGGTGGCGAATGCGATCCGTCGTTCGCGCGCGGGGCTGAGCGACCCG
AAGCGGCCGATTGGCTCGTTTATTTTCCTGGGACCCACGGGCGTCGGCAAGACGGAGACGGCGCGGGCGCTGGCCGAGTTCCTGTTTGAT
GACGAGCAGGCGATGATTCGCATCGACATGAGCGAGTACATGGAGAAGCATGCGGTGGCGCGTTTGATTGGCGCGCCTCCGGGCTATGTG
GGCTATGACGAGGGCGGCCAGTTGACGGAGGCCGTGCGGCGGCGGCCTTACTCGGTGGTGCTGTTTGACGAGATCGAGAAGGCGCATCCG
GATGTGTTCAACGTGCTGCTGCAGGTGCTGGACGACGGGCGGCTGACGGACTCGAAGGGGCGCACGGTGGACTTCAAGAACACGGTGCTC
ATCATGACCTCAAACCTGGGCGCGCAGGCGCTGCATGCCGAGGCGTTGCAGGATGAAGCGGCCTTTGAGCAGGCGCGCGAGCAGGTGATG
GAGGTGCTGCGGCAGAGCTTTAGGCCGGAGTTTTTGAACCGCGTGGATGACATTGTGATCTTCCGTCCGCTGGGCGAAGCGCAACTGGTG
CATATTGTGGATCTGCGGCTCAAGGATCTGGAGCAGTTGCTGAAGGAGCGTCACATCACGATTGAGCTGACGGATGCGGCGCGGCATCAG
CTCTTCCTGAGTGGATATGATCGCGCGTACGGTGCGCGTCCGTTGAAGCGTGCCATGCAGCGGTTGATTCAAGATCCGCTGGCGATGCGG
ATTCTGGATGGAGAGGTGCTGCATGGGGATCATGTGCGGATTGATGCTGATCCGCTCAAGAACCAGTTGAGCTTTGAGGTGACGGGAAGA
GAGGCGGTGAAGTGA

Gene Information
Molecule Type genomic DNA
Bases 2625 Bases
Molecular Weight819469.2 Da
Coding Sequence CP001472.1:2780845..2783469
NCBI ReferenceACO32383
Notesidentified by similarity to SP:Q9RA63; match to

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 19 to 71 53 Clp amino terminal domain PF02861
N Domain 96 to 148 53 Clp amino terminal domain PF02861
NBD_1 205 to 343 139 Nucleotide binding domain 1 PF00004
M Domain 413 to 541 129 Coiled coil Middle domain Manually identified
NBD_2 602 to 768 167 Nucleotide binding domain 2 PF07724
Clp_C 774 to 865 92 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACCA1

Accession Number

HSP100_0015

Added on

2012-02-02

Updated On

2014-01-20