Help  Custom Search
 
heat shock protein HslVU, ATPase subunit HslU. of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

heat shock protein HslVU, ATPase subunit HslU.

Synonymous Names

HSLU_ACIF5, Heat Shock like U.

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpY/HslU)

SEQUENCE INFORMATION

Sequence
MSEMTPREIVQELDKYIIGQSEAKRAVAIALRNRWRRGQVPPPLHQEITPKNILMIGPTGVGKTEIARRL AQLANAPFIKVEATKFTEVGYVGKDVESIIRDLTETAVDMIRNERQVALRQRAEELAEERILDILIPGPR DSSVPRSDEGTRQKFRKMLREGKLDAQEIEIEVSAPKGGVEIMAPAGMEEMTNQLREMFSNMAPGKTSTR RVTVSEAQRLLTDDEAAKLVNEEEVRALALERVQSGGIVFIDEIDKVAVRSGTQQGSDVSREGVQRDLLP LVEGSNVSTRYGVVKTDHILFIASGAFHLSKPSDLIPELQGRLPIRVELEALSAADLVRILQEPENALVR QYGALLASDGLALHFTQDGVQRIAEIAQQVNERVENIGARRLHTVMERLLEEVAFVAPDGSTTALEVDAA YVDSRLKDLAQDEDLSRYIL

FASTA Format Composition Secondary Structure

Nucleotide
 ATGTCTGAAATGACCCCCCGCGAGATCGTCCAGGAGCTGGACAAGTACATCATCGGCCAGTCCGAGGCCAAGCGCGCAGTCGCCATCGC
CCTGCGCAACCGCTGGCGGCGCGGGCAGGTGCCGCCGCCGCTGCATCAGGAAATCACCCCCAAAAATATCCTCATGATCGGGCCGACGGG
AGTGGGCAAGACGGAAATCGCCCGGCGTCTGGCGCAACTCGCCAATGCCCCCTTCATCAAGGTGGAAGCCACCAAATTCACCGAGGTGGG
CTATGTGGGCAAGGATGTGGAATCCATCATCCGCGATCTGACCGAAACCGCCGTCGACATGATCCGCAACGAACGGCAGGTCGCGTTGCG
CCAGCGCGCCGAGGAATTGGCCGAGGAGCGGATTCTCGACATCCTCATCCCCGGTCCGCGCGACAGCAGCGTACCCCGCAGCGACGAGGG
CACTCGCCAGAAGTTTCGAAAAATGCTGCGCGAAGGCAAGCTGGATGCGCAGGAAATCGAGATCGAGGTGAGCGCTCCCAAGGGCGGGGT
GGAGATCATGGCCCCGGCGGGTATGGAGGAGATGACCAACCAGCTCCGCGAGATGTTCTCCAACATGGCGCCAGGGAAGACCAGCACACG
ACGCGTCACCGTGAGCGAAGCGCAGCGTCTGTTGACGGACGATGAAGCCGCCAAGCTGGTCAATGAAGAGGAAGTTCGCGCCCTGGCACT
GGAACGGGTACAGTCCGGCGGCATAGTCTTCATCGACGAAATCGACAAGGTGGCGGTACGCTCCGGCACTCAGCAGGGCTCGGATGTCTC
CCGGGAAGGAGTACAACGCGATCTTCTGCCGCTGGTGGAGGGCTCCAATGTGAGCACCCGTTACGGCGTGGTGAAGACCGACCATATCCT
CTTCATCGCCTCCGGCGCCTTCCACCTCAGCAAGCCCTCCGATCTGATCCCGGAACTGCAGGGTCGCCTGCCTATCCGCGTGGAGTTGGA
GGCCCTGAGTGCGGCGGATCTGGTGCGGATACTGCAGGAGCCGGAGAATGCGCTGGTCCGGCAATACGGTGCGTTGCTGGCCAGCGACGG
GCTGGCTTTACACTTTACCCAGGATGGCGTGCAGCGTATCGCCGAAATTGCCCAGCAGGTGAATGAACGCGTGGAGAACATCGGCGCCCG
GCGCCTGCATACGGTCATGGAGCGGCTGCTGGAAGAGGTGGCTTTTGTCGCACCGGACGGCAGCACCACGGCCCTGGAGGTGGATGCCGC
CTATGTGGACAGCCGTCTGAAAGATCTGGCGCAGGACGAGGATTTATCTCGTTATATTTTGTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine28122 %
Guanine43033 %
Thyamine22017 %
Cytosine39230 %
A+T50138 %
G+C82263 %

Total Bases :   1323 bases

Microsatellites
SequencePosition LengthRepeats
CCCCCC1323
GCGCGC7123
GCCGCCGCC11933
GCGCGC36223
CGCGCG41523

Microsatellite Map

ATGTCTGAAATGACCCCCCGCGAGATCGTCCAGGAGCTGGACAAGTACATCATCGGCCAGTCCGAGGCCAAGCGCGCAGTCGCCATCGCC
CTGCGCAACCGCTGGCGGCGCGGGCAGGTGCCGCCGCCGCTGCATCAGGAAATCACCCCCAAAAATATCCTCATGATCGGGCCGACGGGA
GTGGGCAAGACGGAAATCGCCCGGCGTCTGGCGCAACTCGCCAATGCCCCCTTCATCAAGGTGGAAGCCACCAAATTCACCGAGGTGGGC
TATGTGGGCAAGGATGTGGAATCCATCATCCGCGATCTGACCGAAACCGCCGTCGACATGATCCGCAACGAACGGCAGGTCGCGTTGCGC
CAGCGCGCCGAGGAATTGGCCGAGGAGCGGATTCTCGACATCCTCATCCCCGGTCCGCGCGACAGCAGCGTACCCCGCAGCGACGAGGGC
ACTCGCCAGAAGTTTCGAAAAATGCTGCGCGAAGGCAAGCTGGATGCGCAGGAAATCGAGATCGAGGTGAGCGCTCCCAAGGGCGGGGTG
GAGATCATGGCCCCGGCGGGTATGGAGGAGATGACCAACCAGCTCCGCGAGATGTTCTCCAACATGGCGCCAGGGAAGACCAGCACACGA
CGCGTCACCGTGAGCGAAGCGCAGCGTCTGTTGACGGACGATGAAGCCGCCAAGCTGGTCAATGAAGAGGAAGTTCGCGCCCTGGCACTG
GAACGGGTACAGTCCGGCGGCATAGTCTTCATCGACGAAATCGACAAGGTGGCGGTACGCTCCGGCACTCAGCAGGGCTCGGATGTCTCC
CGGGAAGGAGTACAACGCGATCTTCTGCCGCTGGTGGAGGGCTCCAATGTGAGCACCCGTTACGGCGTGGTGAAGACCGACCATATCCTC
TTCATCGCCTCCGGCGCCTTCCACCTCAGCAAGCCCTCCGATCTGATCCCGGAACTGCAGGGTCGCCTGCCTATCCGCGTGGAGTTGGAG
GCCCTGAGTGCGGCGGATCTGGTGCGGATACTGCAGGAGCCGGAGAATGCGCTGGTCCGGCAATACGGTGCGTTGCTGGCCAGCGACGGG
CTGGCTTTACACTTTACCCAGGATGGCGTGCAGCGTATCGCCGAAATTGCCCAGCAGGTGAATGAACGCGTGGAGAACATCGGCGCCCGG
CGCCTGCATACGGTCATGGAGCGGCTGCTGGAAGAGGTGGCTTTTGTCGCACCGGACGGCAGCACCACGGCCCTGGAGGTGGATGCCGCC
TATGTGGACAGCCGTCTGAAAGATCTGGCGCAGGACGAGGATTTATCTCGTTATATTTTGTGA

Gene Information
Molecule Type genomic DNA
Bases 1323 Bases
Molecular Weight409792.91 Da
Coding Sequence CP001132.1:2340015..2341337
NCBI ReferenceACH84569
NotesKEGG: hha:Hhal_1204 heat shock protein HslVU; ATPase

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
NBD_1 53 to 138 86 Nucleotide binding domain 1 PF00004
NBD_2 166 to 326 161 Nucleotide binding domain 2 PF07724
Clp_C 332 to 427 96 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HslU_ACFE1

Accession Number

HSP100_0014

Added on

2012-02-02

Updated On

2014-01-20