Help  Custom Search
 
ATP-dependent Clp protease, ATP-binding subunit ClpX. of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent Clp protease, ATP-binding subunit ClpX.

Synonymous Names

CLPX_ACIF5, Caseinolytic peptidase X, ClpX.

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpX-Caseinolytic peptidase X)

SEQUENCE INFORMATION

Sequence
MAGKHEGSGEKTLYCSFCGKSQHEVRKLIAGPSVFICDECIELCNDIVKDEILDDHSEAQDKLPKPMEIR KTLDDYVIGQDVAKKVLSVAVYNHYKRLEHGGKDNEVELDKSNILLIGPTGSGKTLLAQTLARLLNVPFA MADATTLTEAGYVGEDVENIIQKLLQKCDYDVEKAQTGIVYIDEIDKITRKSENPSITRDVSGEGVQQAL LKLIEGTVASVPPQGGRKHPQQEFLQVDTRHILFICGGAFAGLEKSVSARLEKGGMGFNAPLKRRDKEAT AAMLMQNLEPEDLVRYGLIPEFVGRLPILALLEELDEEALISILTDPKNALVKQYQKLFALEGVTLEFRT EALRAIAKKALARKTGARGLRSILEQILLDTMYELPSMSGVKKVVVDAAVVESGTKPLLVYDDAAKVDMS HPA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGCTGGAAAGCATGAGGGAAGCGGGGAAAAGACGCTCTATTGTTCGTTCTGTGGCAAGAGCCAGCACGAAGTCCGCAAGCTGATCGC
CGGTCCTTCGGTATTCATCTGTGACGAATGCATCGAGTTGTGCAATGACATCGTCAAGGACGAGATACTGGACGACCACAGCGAGGCTCA
GGACAAGCTGCCCAAGCCCATGGAAATCCGTAAAACGCTGGATGATTACGTCATTGGTCAGGATGTTGCCAAAAAAGTCTTGTCCGTGGC
GGTTTACAATCATTACAAGCGACTGGAACATGGCGGCAAGGACAATGAGGTGGAGCTGGATAAGAGCAACATCCTGCTCATCGGCCCCAC
CGGTTCGGGCAAGACCCTGCTGGCGCAGACCCTGGCGCGCCTCCTGAACGTGCCCTTTGCCATGGCCGATGCCACGACACTCACGGAGGC
CGGCTATGTCGGTGAGGATGTCGAAAACATCATTCAGAAACTGCTGCAGAAGTGTGACTACGATGTGGAAAAGGCGCAGACCGGCATCGT
CTATATCGATGAGATCGACAAGATCACCCGCAAGTCCGAGAACCCCTCCATCACCCGTGATGTTTCCGGTGAAGGCGTGCAGCAGGCGTT
ACTCAAGCTGATTGAAGGGACGGTGGCCTCGGTTCCGCCACAAGGCGGCCGCAAACACCCGCAACAGGAGTTCCTGCAGGTGGACACCCG
GCATATCCTCTTCATCTGTGGTGGTGCCTTTGCGGGTCTGGAGAAGTCGGTCTCCGCGCGTCTGGAGAAGGGCGGTATGGGCTTCAATGC
GCCCCTCAAGCGCCGCGACAAGGAAGCGACCGCCGCCATGCTGATGCAGAATCTGGAGCCGGAAGACCTGGTGCGTTATGGCCTGATTCC
GGAGTTCGTCGGGCGTCTGCCCATTCTGGCGCTGCTGGAAGAGCTGGACGAAGAGGCCCTCATTTCCATCCTCACCGATCCAAAGAATGC
CTTGGTGAAGCAGTACCAGAAGCTTTTTGCCCTGGAAGGCGTGACCCTGGAGTTCCGCACCGAGGCGTTGCGCGCCATTGCCAAAAAGGC
ACTGGCCCGCAAGACCGGGGCACGTGGTTTGCGTTCCATTCTTGAGCAGATTCTGCTGGATACGATGTACGAATTGCCCTCTATGAGTGG
CGTGAAAAAGGTGGTGGTGGATGCCGCCGTCGTGGAAAGCGGCACGAAGCCGCTGCTGGTTTACGATGATGCTGCCAAGGTGGATATGTC
TCATCCGGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine28823 %
Guanine38931 %
Thyamine25621 %
Cytosine33927 %
A+T54443 %
G+C72858 %

Total Bases :   1272 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA24923
GCGCGC39323
GTGGTGGTG73633
CGCGCG77323
GCGCGC105823
GGTGGTGGT117833

Microsatellite Map

ATGGCTGGAAAGCATGAGGGAAGCGGGGAAAAGACGCTCTATTGTTCGTTCTGTGGCAAGAGCCAGCACGAAGTCCGCAAGCTGATCGCC
GGTCCTTCGGTATTCATCTGTGACGAATGCATCGAGTTGTGCAATGACATCGTCAAGGACGAGATACTGGACGACCACAGCGAGGCTCAG
GACAAGCTGCCCAAGCCCATGGAAATCCGTAAAACGCTGGATGATTACGTCATTGGTCAGGATGTTGCCAAAAAAGTCTTGTCCGTGGCG
GTTTACAATCATTACAAGCGACTGGAACATGGCGGCAAGGACAATGAGGTGGAGCTGGATAAGAGCAACATCCTGCTCATCGGCCCCACC
GGTTCGGGCAAGACCCTGCTGGCGCAGACCCTGGCGCGCCTCCTGAACGTGCCCTTTGCCATGGCCGATGCCACGACACTCACGGAGGCC
GGCTATGTCGGTGAGGATGTCGAAAACATCATTCAGAAACTGCTGCAGAAGTGTGACTACGATGTGGAAAAGGCGCAGACCGGCATCGTC
TATATCGATGAGATCGACAAGATCACCCGCAAGTCCGAGAACCCCTCCATCACCCGTGATGTTTCCGGTGAAGGCGTGCAGCAGGCGTTA
CTCAAGCTGATTGAAGGGACGGTGGCCTCGGTTCCGCCACAAGGCGGCCGCAAACACCCGCAACAGGAGTTCCTGCAGGTGGACACCCGG
CATATCCTCTTCATCTGTGGTGGTGCCTTTGCGGGTCTGGAGAAGTCGGTCTCCGCGCGTCTGGAGAAGGGCGGTATGGGCTTCAATGCG
CCCCTCAAGCGCCGCGACAAGGAAGCGACCGCCGCCATGCTGATGCAGAATCTGGAGCCGGAAGACCTGGTGCGTTATGGCCTGATTCCG
GAGTTCGTCGGGCGTCTGCCCATTCTGGCGCTGCTGGAAGAGCTGGACGAAGAGGCCCTCATTTCCATCCTCACCGATCCAAAGAATGCC
TTGGTGAAGCAGTACCAGAAGCTTTTTGCCCTGGAAGGCGTGACCCTGGAGTTCCGCACCGAGGCGTTGCGCGCCATTGCCAAAAAGGCA
CTGGCCCGCAAGACCGGGGCACGTGGTTTGCGTTCCATTCTTGAGCAGATTCTGCTGGATACGATGTACGAATTGCCCTCTATGAGTGGC
GTGAAAAAGGTGGTGGTGGATGCCGCCGTCGTGGAAAGCGGCACGAAGCCGCTGCTGGTTTACGATGATGCTGCCAAGGTGGATATGTCT
CATCCGGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 1272 Bases
Molecular Weight394112.43 Da
Coding Sequence CP001132.1:1000790..1002061
NCBI ReferenceACH83274
NotesKEGG: aeh:Mlg_2287 ATP-dependent protease

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Zf_C4 12 to 51 40 C4_type Zinc finger domain PF06689
NBD_2 109 to 309 201 Nucleotide binding domain 2 PF07724
Clp_C 315 to 406 92 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpX_ACFE1

Accession Number

HSP100_0013

Added on

2012-02-02

Updated On

2014-01-20