Help  Custom Search
 
ATP-dependent Clp protease, ATP-binding subunit clpA. of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent Clp protease, ATP-binding subunit clpA.

Synonymous Names

B5EMZ9_ACIF5, Caseinolytic peptidase A, ClpA.

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpA-Caseinolytic peptidase A)

SEQUENCE INFORMATION

Sequence
MIDKPLEQSINQAFQIARQYGHEYASVEHLLLALLDNPDGMDVLSACGADRTHLSVELRQFLERKVPAMG PAGTVNTQPSIGFQRVIQRALYHVQSAGKDAVSGANVIVAIFAERESHAVYFLQKEHVTRLDVVNFLAHG VRKDEVMDEEEEEVEGTTEKKGDSKDPLTAYARNLNAMARAGRLDPLIGRQEELIRALQVLARRRKNNPL FVGEPGVGKTAIVEGLARAVVAGKVPEMLENATIYALDLGALIAGSRYRGDFEERLKGVLKALRKKPNSI LFIDEIHTLIGAGAASGGAMDASNLLKPALASGELKCIGATTYQEFRQYFEKDRALTRRFQKIDVPEPSQ EESVQILRGLKGQFEQHHGLRYTDTALRAAVELSVKHIHDRHLPDKAIDLIDEVGAAQALLPVSRRKKSI GVHDIEEMVARVARIPGKSVSTDDRQALKNLERDLGFVIFGQEKAIHELSAAIKMARAGLRHHEKPVGSF LFSGPTGVGKTELSRQLASLLGIPLLRFDMSEYMERHTVSRLIGAPPGYVGHDQAGQLTEAVSRNPHAVL LLDEIEKAHPDIFNVLLQVMDHGKLTDAGGRTVDFRNVVLIMTTNAGAEARGKANIGFMNAPQSDGGQEM ETIRRVFAPEFRNRLDAVVPFTPLSKETVLHVVDKFVMELDEQLLQKGYSLEISAELRQWLADKGYDPQM GARPMTRMIQEHLKKPLAEHILFGDLPKGTRITARLENGEVKLEIPVPVHQD

FASTA Format Composition Secondary Structure

Nucleotide
 ATGATCGACAAACCCCTGGAACAGTCCATCAATCAGGCCTTCCAGATTGCCCGCCAGTACGGACATGAATACGCCTCCGTGGAACATCT
CTTACTGGCCCTGCTGGACAACCCCGACGGTATGGATGTGCTCAGCGCCTGTGGCGCCGACCGCACCCATCTGTCTGTGGAACTACGGCA
GTTTCTGGAACGCAAAGTGCCCGCCATGGGTCCGGCGGGCACCGTCAATACCCAGCCGTCCATAGGTTTTCAGCGGGTCATTCAGCGCGC
TCTCTACCATGTGCAGTCGGCGGGTAAGGATGCGGTTTCGGGGGCTAACGTCATTGTCGCCATCTTCGCCGAAAGGGAATCCCACGCTGT
TTATTTCCTACAGAAAGAACATGTGACAAGACTCGATGTGGTCAATTTTCTGGCGCACGGCGTGCGCAAGGATGAAGTCATGGATGAGGA
AGAAGAGGAAGTCGAGGGTACCACGGAAAAGAAGGGAGACAGCAAGGACCCGCTCACAGCTTATGCGCGCAACCTCAACGCCATGGCACG
GGCAGGACGGCTGGACCCGCTGATAGGACGCCAGGAGGAGTTGATCCGGGCCCTGCAGGTGCTGGCACGGCGCCGGAAAAACAACCCCCT
CTTCGTCGGTGAACCAGGTGTCGGGAAAACCGCCATCGTCGAGGGCCTTGCGCGTGCTGTTGTCGCCGGCAAAGTGCCGGAGATGCTGGA
AAACGCGACGATTTATGCTCTGGATTTGGGGGCGTTGATCGCCGGATCCCGCTACCGGGGTGACTTTGAAGAACGCCTGAAAGGGGTGCT
GAAGGCGCTGCGCAAAAAACCCAACAGCATCCTGTTCATCGACGAGATTCACACCCTGATCGGCGCCGGAGCCGCTTCGGGTGGCGCCAT
GGATGCCTCCAATCTGCTGAAGCCGGCTCTCGCCTCCGGTGAACTGAAATGTATCGGGGCGACCACTTATCAGGAGTTCCGCCAGTATTT
TGAGAAGGATCGCGCGCTGACTCGTCGCTTCCAGAAAATTGACGTGCCGGAGCCCTCTCAGGAAGAGTCCGTACAGATTTTGCGCGGACT
GAAGGGACAATTTGAGCAGCATCATGGCCTGCGTTATACCGACACGGCGTTGCGCGCGGCGGTGGAGCTGTCCGTCAAGCACATCCACGA
TCGCCATCTACCCGACAAGGCCATTGATCTCATCGACGAGGTGGGCGCCGCGCAAGCGCTTTTGCCAGTCTCCCGACGCAAGAAGAGCAT
CGGTGTGCACGACATCGAGGAAATGGTCGCCCGGGTGGCCCGTATTCCGGGTAAGAGCGTCTCTACCGATGATCGTCAGGCCCTGAAGAA
TCTGGAGCGGGATCTGGGATTCGTCATCTTTGGTCAGGAAAAGGCCATCCACGAACTCTCCGCGGCCATCAAAATGGCACGGGCAGGCCT
GCGCCACCATGAAAAGCCGGTGGGGAGTTTTCTCTTCTCCGGCCCGACCGGCGTGGGTAAGACCGAGCTCAGCCGGCAGTTGGCCAGCCT
GCTCGGCATTCCGCTACTGCGTTTCGACATGAGTGAATACATGGAACGGCATACGGTGTCACGACTCATCGGTGCACCGCCAGGATATGT
CGGGCATGATCAGGCTGGACAACTGACGGAGGCGGTGAGCCGTAATCCACATGCGGTGCTGTTGTTGGATGAAATTGAGAAGGCACACCC
GGATATCTTCAATGTGCTCCTGCAAGTGATGGATCACGGCAAGCTGACAGATGCCGGCGGCCGCACGGTGGACTTCCGCAATGTGGTGCT
CATTATGACCACCAATGCGGGGGCTGAGGCGCGCGGCAAAGCGAATATTGGTTTCATGAACGCCCCCCAGAGTGATGGCGGACAGGAAAT
GGAGACCATCCGCCGGGTCTTCGCACCGGAATTTCGCAACCGCCTGGATGCCGTCGTACCCTTCACACCGCTTTCTAAGGAGACGGTGCT
ACACGTGGTGGATAAGTTCGTCATGGAACTGGACGAGCAGTTGCTGCAAAAGGGCTATAGCCTGGAAATCAGCGCTGAACTACGGCAATG
GCTGGCGGACAAGGGCTACGACCCGCAGATGGGCGCCCGGCCGATGACGCGGATGATTCAGGAGCACCTGAAGAAGCCGCTGGCGGAGCA
TATCCTCTTTGGCGACCTACCCAAGGGCACGCGAATCACTGCGCGCCTCGAGAACGGTGAGGTGAAACTGGAAATACCGGTGCCCGTGCA
TCAAGACTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine50423 %
Guanine69531 %
Thyamine42919 %
Cytosine63128 %
A+T93342 %
G+C132659 %

Total Bases :   2259 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC26323
GCGCGC51323
AAAAAA82223
CGCGCG99923
GCGCGC113023
GCGCGC182723
CCCCCC186123
GCGCGC219923

Microsatellite Map

ATGATCGACAAACCCCTGGAACAGTCCATCAATCAGGCCTTCCAGATTGCCCGCCAGTACGGACATGAATACGCCTCCGTGGAACATCTC
TTACTGGCCCTGCTGGACAACCCCGACGGTATGGATGTGCTCAGCGCCTGTGGCGCCGACCGCACCCATCTGTCTGTGGAACTACGGCAG
TTTCTGGAACGCAAAGTGCCCGCCATGGGTCCGGCGGGCACCGTCAATACCCAGCCGTCCATAGGTTTTCAGCGGGTCATTCAGCGCGCT
CTCTACCATGTGCAGTCGGCGGGTAAGGATGCGGTTTCGGGGGCTAACGTCATTGTCGCCATCTTCGCCGAAAGGGAATCCCACGCTGTT
TATTTCCTACAGAAAGAACATGTGACAAGACTCGATGTGGTCAATTTTCTGGCGCACGGCGTGCGCAAGGATGAAGTCATGGATGAGGAA
GAAGAGGAAGTCGAGGGTACCACGGAAAAGAAGGGAGACAGCAAGGACCCGCTCACAGCTTATGCGCGCAACCTCAACGCCATGGCACGG
GCAGGACGGCTGGACCCGCTGATAGGACGCCAGGAGGAGTTGATCCGGGCCCTGCAGGTGCTGGCACGGCGCCGGAAAAACAACCCCCTC
TTCGTCGGTGAACCAGGTGTCGGGAAAACCGCCATCGTCGAGGGCCTTGCGCGTGCTGTTGTCGCCGGCAAAGTGCCGGAGATGCTGGAA
AACGCGACGATTTATGCTCTGGATTTGGGGGCGTTGATCGCCGGATCCCGCTACCGGGGTGACTTTGAAGAACGCCTGAAAGGGGTGCTG
AAGGCGCTGCGCAAAAAACCCAACAGCATCCTGTTCATCGACGAGATTCACACCCTGATCGGCGCCGGAGCCGCTTCGGGTGGCGCCATG
GATGCCTCCAATCTGCTGAAGCCGGCTCTCGCCTCCGGTGAACTGAAATGTATCGGGGCGACCACTTATCAGGAGTTCCGCCAGTATTTT
GAGAAGGATCGCGCGCTGACTCGTCGCTTCCAGAAAATTGACGTGCCGGAGCCCTCTCAGGAAGAGTCCGTACAGATTTTGCGCGGACTG
AAGGGACAATTTGAGCAGCATCATGGCCTGCGTTATACCGACACGGCGTTGCGCGCGGCGGTGGAGCTGTCCGTCAAGCACATCCACGAT
CGCCATCTACCCGACAAGGCCATTGATCTCATCGACGAGGTGGGCGCCGCGCAAGCGCTTTTGCCAGTCTCCCGACGCAAGAAGAGCATC
GGTGTGCACGACATCGAGGAAATGGTCGCCCGGGTGGCCCGTATTCCGGGTAAGAGCGTCTCTACCGATGATCGTCAGGCCCTGAAGAAT
CTGGAGCGGGATCTGGGATTCGTCATCTTTGGTCAGGAAAAGGCCATCCACGAACTCTCCGCGGCCATCAAAATGGCACGGGCAGGCCTG
CGCCACCATGAAAAGCCGGTGGGGAGTTTTCTCTTCTCCGGCCCGACCGGCGTGGGTAAGACCGAGCTCAGCCGGCAGTTGGCCAGCCTG
CTCGGCATTCCGCTACTGCGTTTCGACATGAGTGAATACATGGAACGGCATACGGTGTCACGACTCATCGGTGCACCGCCAGGATATGTC
GGGCATGATCAGGCTGGACAACTGACGGAGGCGGTGAGCCGTAATCCACATGCGGTGCTGTTGTTGGATGAAATTGAGAAGGCACACCCG
GATATCTTCAATGTGCTCCTGCAAGTGATGGATCACGGCAAGCTGACAGATGCCGGCGGCCGCACGGTGGACTTCCGCAATGTGGTGCTC
ATTATGACCACCAATGCGGGGGCTGAGGCGCGCGGCAAAGCGAATATTGGTTTCATGAACGCCCCCCAGAGTGATGGCGGACAGGAAATG
GAGACCATCCGCCGGGTCTTCGCACCGGAATTTCGCAACCGCCTGGATGCCGTCGTACCCTTCACACCGCTTTCTAAGGAGACGGTGCTA
CACGTGGTGGATAAGTTCGTCATGGAACTGGACGAGCAGTTGCTGCAAAAGGGCTATAGCCTGGAAATCAGCGCTGAACTACGGCAATGG
CTGGCGGACAAGGGCTACGACCCGCAGATGGGCGCCCGGCCGATGACGCGGATGATTCAGGAGCACCTGAAGAAGCCGCTGGCGGAGCAT
ATCCTCTTTGGCGACCTACCCAAGGGCACGCGAATCACTGCGCGCCTCGAGAACGGTGAGGTGAAACTGGAAATACCGGTGCCCGTGCAT
CAAGACTGA

Gene Information
Molecule Type genomic DNA
Bases 2259 Bases
Molecular Weight699571.21 Da
Coding Sequence complement(CP001132.1:629301..631559)
NCBI ReferenceACH82929
NotesKEGG: mca:MCA1789 ATP-dependent Clp protease;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 13 to 63 51 Clp amino terminal domain PF02861
NBD_1 209 to 346 138 Nucleotide binding domain 1 PF00004
NBD_2 485 to 648 164 Nucleotide binding domain 2 PF07724
Clp_C 654 to 753 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpA_ACFE1

Accession Number

HSP100_0012

Added on

2012-02-02

Updated On

2014-01-20