Help  Custom Search
 
ATP-dependent chaperone ClpB. of Acidithiobacillus ferrooxidans str. ATCC 53993

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent chaperone ClpB.

Synonymous Names

B5EJS9_ACIF5, Caseinolytic peptidase B, ClpB.

Taxon Information

Organism

Acidithiobacillus ferrooxidans str. ATCC 53993

Organism ID

380394 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales; Acidithiobacillaceae; Acidithiobacillus; Acidithiobacillus ferrooxidans ATCC 53993

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MRTDKLTTKFQQAFQDAQSLALAQDHQQMEPIHLLAAFLDQEGGIARPLLSKAGVRVDALRNQLNRALES MPKVQGHPGEVQVGRDLTNMLNLADKIGQKRGDTYISTEHFLLALMDDKGEAGRLLKEAGATTKDLEQAV HDLHGGEKINDANAEEQRQALEKYTIDYTERASQGKLDPVIGRDDEIRRTIQVLLRRSKNNPVLIGEPGV GKTAIVEGLALRLINGEVPESLRDKRLLGLDLGALIAGAKFRGEFEERLKSLLNDLEKSEGKIILFIDEI HTLVGAGKAEGSMDAGNMLKPALARGELHCIGATTLDEYRKYIEKDAALERRFQRVLVDEPSVEDAIAIL RGLKERYEAHHGVRITDPALVAAVQLSHRYITDRNLPDKAIDLMDEAASRIKMEIDSKPQELDELERRII QLNIERVALEKEKDEASRKRLDILQAQIKESDRKYQELEEVWKGEKLAIEGTSQIQKELDRKRVELDTAR RANDLERMAELQYSSIPALEAQLHAAEIHAQSAGSGAKPTLLRTEVGEEEIAEVVARWTGIPVSKMLEGE KEKLLKMEERLQARVVGQSEAVAAVSNAIRRSRAGLSDPKRPNGSFLFLGPTGVGKTELTKALAEFLFDS EDHLVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVVLLDEVEKAHPEVFNILLQVLD DGRLTDGQGRTVDFRNTVIVMTSNLGSDRIQEFSRKGEYDSMRVAVLDVVQDHFRPEFLNRIDELVIFRP LTAVQLREITGIQMGFLRSRLRERDMDLVLSDGALDHLAEVGYDPVYGARPLKRVIQREIENPLAQKLLR GDFGPGEIIEVVLEGDRFTFVGQRVH

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCGTACCGACAAACTGACTACCAAATTCCAACAGGCTTTTCAGGATGCTCAGAGTCTTGCGCTGGCGCAGGATCACCAGCAGATGGA
GCCCATCCACTTGCTTGCTGCTTTTCTTGATCAGGAAGGAGGTATCGCTCGGCCACTCCTGTCAAAGGCCGGCGTGCGGGTCGATGCCCT
ACGCAACCAGTTGAACCGCGCGCTGGAGTCCATGCCGAAGGTACAAGGGCATCCGGGCGAGGTGCAGGTGGGCCGCGATCTTACCAATAT
GCTCAATCTGGCAGACAAGATAGGCCAGAAGCGCGGCGACACGTATATCTCCACCGAACACTTCCTGCTGGCCTTGATGGACGACAAGGG
CGAGGCGGGGCGCCTCCTGAAAGAGGCGGGTGCCACCACCAAGGATCTGGAACAGGCCGTCCACGATCTGCACGGCGGGGAAAAAATCAA
TGATGCCAATGCCGAAGAGCAACGTCAGGCACTGGAGAAATATACCATTGACTACACCGAACGGGCCAGTCAAGGCAAGCTGGACCCGGT
GATCGGCCGTGACGACGAAATCCGCCGGACCATTCAGGTATTGCTGCGGCGCAGCAAAAATAATCCGGTGTTGATCGGTGAACCAGGTGT
GGGCAAAACCGCTATTGTCGAGGGCCTGGCACTGCGCTTGATTAATGGCGAAGTGCCCGAATCTTTGCGCGATAAGCGCCTTCTGGGTTT
GGACTTGGGGGCACTGATTGCCGGTGCCAAGTTTCGCGGTGAGTTCGAGGAACGTCTGAAGTCGTTATTGAACGACCTGGAGAAGAGTGA
GGGTAAAATCATTCTTTTTATTGATGAAATTCATACGCTGGTGGGGGCTGGCAAGGCCGAGGGCTCCATGGACGCGGGCAATATGCTCAA
GCCGGCGCTGGCGCGCGGCGAGTTACATTGCATCGGTGCCACCACACTGGATGAATATCGTAAATATATTGAAAAAGATGCGGCGCTGGA
ACGACGTTTCCAGCGGGTGCTGGTGGATGAACCCAGTGTGGAAGACGCCATCGCCATTTTGCGTGGCCTGAAAGAACGCTATGAAGCTCA
TCATGGGGTACGCATTACCGATCCGGCGCTGGTCGCCGCAGTGCAGCTTTCACACCGCTATATCACCGACCGTAATCTGCCTGACAAAGC
CATAGATCTGATGGATGAAGCGGCCTCCCGCATCAAGATGGAAATCGATTCCAAACCTCAGGAACTGGATGAACTGGAGCGCCGTATCAT
TCAGTTGAACATCGAGCGCGTGGCGCTGGAGAAGGAGAAGGATGAGGCCAGCCGTAAGCGCCTGGATATTCTGCAGGCCCAAATCAAAGA
GTCAGATCGAAAATATCAGGAGCTGGAAGAAGTTTGGAAAGGCGAAAAGCTGGCTATCGAAGGTACCTCACAGATTCAGAAAGAACTGGA
TCGCAAGCGCGTGGAGCTGGACACGGCGCGTCGTGCCAACGACTTGGAGCGTATGGCGGAACTGCAATACAGCTCTATTCCGGCATTGGA
AGCACAGCTCCATGCCGCTGAAATCCATGCGCAATCAGCAGGTTCAGGCGCTAAACCCACGTTGTTGCGCACCGAGGTGGGTGAAGAGGA
AATCGCCGAAGTGGTGGCCCGCTGGACCGGCATTCCTGTCTCCAAAATGCTGGAGGGTGAAAAAGAAAAACTCCTCAAGATGGAGGAGCG
CCTGCAGGCGCGGGTAGTGGGTCAGAGCGAGGCGGTGGCCGCGGTATCCAACGCCATTCGCCGCTCCCGGGCGGGGCTGTCTGACCCCAA
GCGTCCCAATGGCTCTTTCCTTTTTCTTGGCCCCACGGGCGTCGGCAAAACGGAGTTGACCAAGGCCCTTGCCGAATTTCTCTTCGACAG
TGAAGACCACCTGGTGCGCATCGACATGAGCGAATTCATGGAGAAGCATTCGGTGGCACGGCTCATTGGCGCGCCTCCGGGATACGTAGG
TTATGAAGAAGGAGGCTATCTCACTGAAGCCGTGCGGCGCAAACCGTATTCGGTCGTATTGCTGGACGAGGTGGAGAAGGCCCACCCGGA
AGTCTTCAATATCCTCCTGCAGGTACTGGATGACGGTCGGCTCACCGATGGCCAGGGGCGCACGGTAGATTTCCGCAATACCGTCATCGT
CATGACTTCCAATCTCGGCTCCGACCGAATTCAGGAATTCAGTCGCAAAGGGGAGTATGACAGTATGCGCGTGGCGGTACTGGACGTGGT
GCAGGATCACTTCCGTCCGGAGTTCCTCAACCGCATTGATGAGCTGGTCATCTTCCGTCCCCTCACCGCGGTGCAACTCCGTGAGATTAC
CGGGATTCAGATGGGCTTCCTGCGGTCACGCCTGCGCGAGCGGGATATGGATCTGGTACTCAGTGATGGCGCACTGGACCATCTGGCCGA
GGTCGGTTATGACCCCGTCTACGGCGCTCGCCCCCTGAAAAGGGTGATTCAGCGGGAGATCGAAAATCCCCTTGCCCAAAAACTCCTGCG
TGGTGACTTCGGACCCGGTGAGATTATTGAAGTGGTTCTTGAAGGAGACCGCTTTACCTTTGTCGGACAGCGGGTGCACTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine60924 %
Guanine79231 %
Thyamine52121 %
Cytosine67927 %
A+T113044 %
G+C147157 %

Total Bases :   2601 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG19523
CCACCACCA39133
AAAAAA43923
GCGCGC90923
ATATAT96223
GCGCGC195723

Microsatellite Map

ATGCGTACCGACAAACTGACTACCAAATTCCAACAGGCTTTTCAGGATGCTCAGAGTCTTGCGCTGGCGCAGGATCACCAGCAGATGGAG
CCCATCCACTTGCTTGCTGCTTTTCTTGATCAGGAAGGAGGTATCGCTCGGCCACTCCTGTCAAAGGCCGGCGTGCGGGTCGATGCCCTA
CGCAACCAGTTGAACCGCGCGCTGGAGTCCATGCCGAAGGTACAAGGGCATCCGGGCGAGGTGCAGGTGGGCCGCGATCTTACCAATATG
CTCAATCTGGCAGACAAGATAGGCCAGAAGCGCGGCGACACGTATATCTCCACCGAACACTTCCTGCTGGCCTTGATGGACGACAAGGGC
GAGGCGGGGCGCCTCCTGAAAGAGGCGGGTGCCACCACCAAGGATCTGGAACAGGCCGTCCACGATCTGCACGGCGGGGAAAAAATCAAT
GATGCCAATGCCGAAGAGCAACGTCAGGCACTGGAGAAATATACCATTGACTACACCGAACGGGCCAGTCAAGGCAAGCTGGACCCGGTG
ATCGGCCGTGACGACGAAATCCGCCGGACCATTCAGGTATTGCTGCGGCGCAGCAAAAATAATCCGGTGTTGATCGGTGAACCAGGTGTG
GGCAAAACCGCTATTGTCGAGGGCCTGGCACTGCGCTTGATTAATGGCGAAGTGCCCGAATCTTTGCGCGATAAGCGCCTTCTGGGTTTG
GACTTGGGGGCACTGATTGCCGGTGCCAAGTTTCGCGGTGAGTTCGAGGAACGTCTGAAGTCGTTATTGAACGACCTGGAGAAGAGTGAG
GGTAAAATCATTCTTTTTATTGATGAAATTCATACGCTGGTGGGGGCTGGCAAGGCCGAGGGCTCCATGGACGCGGGCAATATGCTCAAG
CCGGCGCTGGCGCGCGGCGAGTTACATTGCATCGGTGCCACCACACTGGATGAATATCGTAAATATATTGAAAAAGATGCGGCGCTGGAA
CGACGTTTCCAGCGGGTGCTGGTGGATGAACCCAGTGTGGAAGACGCCATCGCCATTTTGCGTGGCCTGAAAGAACGCTATGAAGCTCAT
CATGGGGTACGCATTACCGATCCGGCGCTGGTCGCCGCAGTGCAGCTTTCACACCGCTATATCACCGACCGTAATCTGCCTGACAAAGCC
ATAGATCTGATGGATGAAGCGGCCTCCCGCATCAAGATGGAAATCGATTCCAAACCTCAGGAACTGGATGAACTGGAGCGCCGTATCATT
CAGTTGAACATCGAGCGCGTGGCGCTGGAGAAGGAGAAGGATGAGGCCAGCCGTAAGCGCCTGGATATTCTGCAGGCCCAAATCAAAGAG
TCAGATCGAAAATATCAGGAGCTGGAAGAAGTTTGGAAAGGCGAAAAGCTGGCTATCGAAGGTACCTCACAGATTCAGAAAGAACTGGAT
CGCAAGCGCGTGGAGCTGGACACGGCGCGTCGTGCCAACGACTTGGAGCGTATGGCGGAACTGCAATACAGCTCTATTCCGGCATTGGAA
GCACAGCTCCATGCCGCTGAAATCCATGCGCAATCAGCAGGTTCAGGCGCTAAACCCACGTTGTTGCGCACCGAGGTGGGTGAAGAGGAA
ATCGCCGAAGTGGTGGCCCGCTGGACCGGCATTCCTGTCTCCAAAATGCTGGAGGGTGAAAAAGAAAAACTCCTCAAGATGGAGGAGCGC
CTGCAGGCGCGGGTAGTGGGTCAGAGCGAGGCGGTGGCCGCGGTATCCAACGCCATTCGCCGCTCCCGGGCGGGGCTGTCTGACCCCAAG
CGTCCCAATGGCTCTTTCCTTTTTCTTGGCCCCACGGGCGTCGGCAAAACGGAGTTGACCAAGGCCCTTGCCGAATTTCTCTTCGACAGT
GAAGACCACCTGGTGCGCATCGACATGAGCGAATTCATGGAGAAGCATTCGGTGGCACGGCTCATTGGCGCGCCTCCGGGATACGTAGGT
TATGAAGAAGGAGGCTATCTCACTGAAGCCGTGCGGCGCAAACCGTATTCGGTCGTATTGCTGGACGAGGTGGAGAAGGCCCACCCGGAA
GTCTTCAATATCCTCCTGCAGGTACTGGATGACGGTCGGCTCACCGATGGCCAGGGGCGCACGGTAGATTTCCGCAATACCGTCATCGTC
ATGACTTCCAATCTCGGCTCCGACCGAATTCAGGAATTCAGTCGCAAAGGGGAGTATGACAGTATGCGCGTGGCGGTACTGGACGTGGTG
CAGGATCACTTCCGTCCGGAGTTCCTCAACCGCATTGATGAGCTGGTCATCTTCCGTCCCCTCACCGCGGTGCAACTCCGTGAGATTACC
GGGATTCAGATGGGCTTCCTGCGGTCACGCCTGCGCGAGCGGGATATGGATCTGGTACTCAGTGATGGCGCACTGGACCATCTGGCCGAG
GTCGGTTATGACCCCGTCTACGGCGCTCGCCCCCTGAAAAGGGTGATTCAGCGGGAGATCGAAAATCCCCTTGCCCAAAAACTCCTGCGT
GGTGACTTCGGACCCGGTGAGATTATTGAAGTGGTTCTTGAAGGAGACCGCTTTACCTTTGTCGGACAGCGGGTGCACTGA

Gene Information
Molecule Type genomic DNA
Bases 2601 Bases
Molecular Weight806258.67 Da
Coding Sequence complement(CP001132.1:1606221..1608821)
NCBI ReferenceACH83860
NotesKEGG: aeh:Mlg_2558 ATPase AAA-2 domain protein;

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 17 to 69 53 Clp amino terminal domain PF02861
N Domain 94 to 143 50 Clp amino terminal domain PF02861
NBD_1 202 to 340 139 Nucleotide binding domain 1 PF00004
M Domain 399 to 464 66 Coiled coil Middle domain Manually identified
NBD_2 601 to 765 165 Nucleotide binding domain 2 PF07724
Clp_C 771 to 860 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACFE1

Accession Number

HSP100_0011

Added on

2012-02-02

Updated On

2014-01-20