Help  Custom Search
 
ATP-dependent protease ATP-binding subunit HslU. of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent protease ATP-binding subunit HslU.

Synonymous Names

A5FYD7_ACICJ, Unfoldase HslU, Heat Shock like U.

Gene names

Gene Name

hslU

Gene Locus Tag

Acry_1409

Gene Identifier

5160993

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpY/HslU)

SEQUENCE INFORMATION

Sequence
MIDSPTYTPREIVSELDRFIVGQQDAKRAVAIALRNRWRRQQLPEGLREEVVPKNILMIGPTGCGKTEIA RRLAKLAQAPFIKVEATKFTEVGYVGRDVESIVRDLVEVSITMLRDMSRKGVQARAELAAEDRLLTALVG EGASSETRNRFRRMLRDGEMEEKEIDVDVSEAPPNVIGQMDMPGMPPGGAINLGDMMKSMFGRQHGRKRM TVAAARAALEREEADRLLDNEQLTADARLHAETHGIVFLDEIDKICARTESGFRGGDVSREGVQRDLLPL IEGTTVSTKYGPVKTDHILFIASGAFHVAKPSDLLPELQGRLPIRVELASLSREDFRRILTEPEHSLLKQ YVALMKTENVDLHFTDDAVDAVAALAADINDRVENIGARRLATVLERLLEEISFAATDRAGETVTVDAAL VNDKVAPLAARGDLGRFIL

FASTA Format Composition Secondary Structure

Nucleotide
 GTGATCGACAGCCCGACCTACACGCCCCGCGAAATCGTCTCCGAGCTCGACCGCTTCATCGTCGGCCAGCAGGACGCGAAGCGCGCCGT
CGCCATCGCGCTGCGCAACCGATGGCGCCGCCAGCAGCTCCCCGAGGGGCTGCGCGAGGAGGTGGTGCCGAAGAACATCCTGATGATCGG
GCCGACCGGCTGCGGCAAGACCGAGATCGCCCGCCGCCTCGCCAAGCTCGCCCAGGCGCCGTTCATCAAGGTCGAGGCGACGAAATTCAC
CGAGGTGGGCTATGTTGGCCGCGATGTGGAAAGCATCGTGCGCGACCTCGTCGAGGTGTCCATCACGATGCTGCGCGACATGAGCCGCAA
GGGCGTGCAGGCCCGCGCCGAACTCGCCGCCGAGGATCGGCTGCTGACCGCGCTGGTGGGCGAGGGGGCCTCGTCGGAGACGCGCAACCG
CTTCCGCCGGATGCTGCGCGACGGCGAGATGGAAGAAAAGGAAATCGACGTCGACGTGAGCGAGGCGCCGCCCAACGTGATCGGCCAGAT
GGACATGCCGGGCATGCCGCCGGGCGGCGCGATCAATCTCGGCGACATGATGAAGTCGATGTTCGGCCGCCAGCATGGCCGCAAGCGGAT
GACCGTCGCCGCCGCCCGCGCCGCGCTGGAGCGCGAGGAGGCCGACCGCCTGCTCGACAACGAGCAGCTGACCGCCGATGCCCGCCTGCA
CGCCGAGACGCACGGCATCGTCTTTCTCGACGAGATCGACAAGATCTGCGCGCGCACCGAAAGCGGCTTCCGCGGTGGCGACGTCTCGCG
CGAGGGCGTGCAGCGCGACCTGCTGCCGCTGATCGAGGGCACGACGGTCTCGACCAAATACGGTCCGGTGAAGACCGATCACATTCTCTT
CATCGCCTCGGGCGCGTTCCACGTCGCCAAGCCGTCGGACCTGCTGCCGGAACTGCAGGGGCGGCTGCCGATCCGCGTCGAGCTCGCCTC
GCTCTCGCGCGAGGATTTCCGCCGCATCCTGACCGAGCCGGAACATTCCCTGCTCAAGCAGTATGTCGCGCTGATGAAGACCGAGAATGT
CGACCTGCACTTCACCGACGACGCGGTCGATGCCGTGGCGGCGCTGGCGGCCGACATCAACGACCGGGTCGAGAATATCGGCGCGCGTCG
GCTGGCCACGGTGCTGGAGCGGCTGCTCGAGGAGATCAGCTTCGCCGCGACCGACCGCGCCGGCGAGACCGTGACGGTCGACGCCGCCCT
GGTCAACGACAAGGTCGCCCCGCTCGCCGCGCGCGGCGATCTCGGCCGCTTCATCCTGTAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine23018 %
Guanine44834 %
Thyamine18515 %
Cytosine45735 %
A+T41532 %
G+C90569 %

Total Bases :   1320 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC8023
CGCCGCCGC63533
GCGCGCGC76624
CGCGCG80523
CGCGCG99423
GCGCGC115923
CGCGCGCG128624

Microsatellite Map

GTGATCGACAGCCCGACCTACACGCCCCGCGAAATCGTCTCCGAGCTCGACCGCTTCATCGTCGGCCAGCAGGACGCGAAGCGCGCCGTC
GCCATCGCGCTGCGCAACCGATGGCGCCGCCAGCAGCTCCCCGAGGGGCTGCGCGAGGAGGTGGTGCCGAAGAACATCCTGATGATCGGG
CCGACCGGCTGCGGCAAGACCGAGATCGCCCGCCGCCTCGCCAAGCTCGCCCAGGCGCCGTTCATCAAGGTCGAGGCGACGAAATTCACC
GAGGTGGGCTATGTTGGCCGCGATGTGGAAAGCATCGTGCGCGACCTCGTCGAGGTGTCCATCACGATGCTGCGCGACATGAGCCGCAAG
GGCGTGCAGGCCCGCGCCGAACTCGCCGCCGAGGATCGGCTGCTGACCGCGCTGGTGGGCGAGGGGGCCTCGTCGGAGACGCGCAACCGC
TTCCGCCGGATGCTGCGCGACGGCGAGATGGAAGAAAAGGAAATCGACGTCGACGTGAGCGAGGCGCCGCCCAACGTGATCGGCCAGATG
GACATGCCGGGCATGCCGCCGGGCGGCGCGATCAATCTCGGCGACATGATGAAGTCGATGTTCGGCCGCCAGCATGGCCGCAAGCGGATG
ACCGTCGCCGCCGCCCGCGCCGCGCTGGAGCGCGAGGAGGCCGACCGCCTGCTCGACAACGAGCAGCTGACCGCCGATGCCCGCCTGCAC
GCCGAGACGCACGGCATCGTCTTTCTCGACGAGATCGACAAGATCTGCGCGCGCACCGAAAGCGGCTTCCGCGGTGGCGACGTCTCGCGC
GAGGGCGTGCAGCGCGACCTGCTGCCGCTGATCGAGGGCACGACGGTCTCGACCAAATACGGTCCGGTGAAGACCGATCACATTCTCTTC
ATCGCCTCGGGCGCGTTCCACGTCGCCAAGCCGTCGGACCTGCTGCCGGAACTGCAGGGGCGGCTGCCGATCCGCGTCGAGCTCGCCTCG
CTCTCGCGCGAGGATTTCCGCCGCATCCTGACCGAGCCGGAACATTCCCTGCTCAAGCAGTATGTCGCGCTGATGAAGACCGAGAATGTC
GACCTGCACTTCACCGACGACGCGGTCGATGCCGTGGCGGCGCTGGCGGCCGACATCAACGACCGGGTCGAGAATATCGGCGCGCGTCGG
CTGGCCACGGTGCTGGAGCGGCTGCTCGAGGAGATCAGCTTCGCCGCGACCGACCGCGCCGGCGAGACCGTGACGGTCGACGCCGCCCTG
GTCAACGACAAGGTCGCCCCGCTCGCCGCGCGCGGCGATCTCGGCCGCTTCATCCTGTAA

Gene Information
Molecule Type genomic DNA
Bases 1320 Bases
Molecular Weight407894.68 Da
Coding Sequence complement(CP000697.1:1565168..1566487)
NCBI ReferenceABQ30619
NotesTIGRFAM: heat shock protein HslVU; ATPase subunit

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
NBD_1 56 to 152 97 Nucleotide binding domain 1 PF00004
NBD_2 177 to 325 149 Nucleotide binding domain 2 PF07724
Clp_C 331 to 425 95 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

HslU_ACCR1

Accession Number

HSP100_0010

Added on

2012-02-02

Updated On

2014-01-20