Help  Custom Search
 
ATP-dependent protease ATP-binding subunit. of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent protease ATP-binding subunit.

Synonymous Names

CLPX_ACICJ, ATP-dependent Clp protease ATP-binding subunit ClpX, Caseinolytic peptidase X, ClpX.

Gene names

Gene Name

clpX

Gene Locus Tag

Acry_0918

Gene Identifier

5160394

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class II Clp Proteins
(ClpX-Caseinolytic peptidase X)

SEQUENCE INFORMATION

Sequence
MSTKSGDSKNTLYCSFCGKSQHEVVKLIAGPTVFICNECVELCMDIIREDNRTHLVKTRDGVPTPREICK VLDDYVIGQDHAKRILSVAVHNHYKRLAHAQKNNDIEIAKSNIMLVGPTGSGKTLLAQTLARILDVPFTM ADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALL KIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIIAQRGKGSGIGFGADVRDPTEQRTG AILREVEPEDLLKFGLIPEFIGRLPVVATLEDLDEAALIEILTKPKNALVKQYGRLFEMEGVKLNFTEDA LKVVAARAIQRKTGARGLRSIMENILLETMFDLPGLDSVEEVVINGEVAEGRANPLFLHGKERAETGS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGAGCACGAAGTCCGGAGACTCGAAGAACACCCTGTATTGCTCGTTTTGCGGCAAGTCGCAGCACGAAGTGGTCAAGCTGATCGCGGG
GCCGACGGTATTCATCTGCAATGAATGCGTCGAACTCTGCATGGACATCATTCGCGAGGATAACCGGACGCACCTCGTGAAAACGCGCGA
CGGCGTGCCGACGCCCCGCGAAATCTGCAAGGTGCTGGACGATTACGTGATCGGGCAGGATCACGCCAAGCGGATTCTCAGTGTTGCCGT
GCACAACCACTACAAGCGGCTGGCGCACGCGCAGAAGAACAACGACATCGAGATCGCGAAGTCGAACATCATGCTGGTCGGGCCCACCGG
CTCGGGCAAGACGCTGCTCGCCCAGACGCTGGCCCGGATTCTCGACGTGCCGTTCACCATGGCGGACGCGACGACCCTGACCGAGGCGGG
ATATGTCGGCGAGGATGTCGAGAACATCATCCTCAAGCTGCTGCAGGCCGCGGATTACAATGTCGAGCGGGCGCAGCGCGGCATCGTCTA
TATCGACGAGGTCGACAAGATCAGCCGCAAGTCCGACAACCCCTCAATCACGCGCGACGTATCCGGCGAGGGCGTGCAGCAGGCGCTGCT
CAAGATCATGGAAGGGACGGTGGCCTCGGTGCCGCCGCAGGGCGGGCGGAAGCATCCGCAACAGGAGTTCCTCCAGGTTGATACCACCAA
CATCCTCTTCATCTGCGGCGGCGCCTTCGCCGGGCTGGAGAAGATCATCGCACAGCGTGGCAAGGGGTCGGGAATCGGCTTCGGCGCCGA
TGTGCGCGACCCGACGGAGCAGCGCACCGGCGCGATCCTGCGCGAAGTCGAGCCCGAGGATCTGCTGAAGTTCGGCCTGATCCCCGAATT
CATTGGCCGTCTGCCCGTCGTTGCGACGCTCGAGGACCTCGACGAGGCGGCGCTGATCGAGATCCTCACCAAGCCGAAGAACGCGCTTGT
GAAGCAATACGGCCGCCTTTTCGAAATGGAGGGCGTGAAGCTCAACTTCACCGAAGACGCGCTGAAAGTGGTCGCCGCCCGTGCGATCCA
GCGCAAGACCGGGGCGCGTGGCCTGCGGTCGATCATGGAAAACATCCTGCTCGAGACGATGTTCGACCTCCCGGGCCTCGACTCGGTCGA
AGAGGTCGTGATCAACGGCGAAGTAGCCGAGGGGCGGGCAAATCCGCTTTTCCTGCATGGCAAGGAACGCGCTGAAACCGGCTCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine27022 %
Guanine40333 %
Thyamine20317 %
Cytosine38131 %
A+T47338 %
G+C78463 %

Total Bases :   1257 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG17223
CGCGCG58923
GCGGCGGCG73333

Microsatellite Map

ATGAGCACGAAGTCCGGAGACTCGAAGAACACCCTGTATTGCTCGTTTTGCGGCAAGTCGCAGCACGAAGTGGTCAAGCTGATCGCGGGG
CCGACGGTATTCATCTGCAATGAATGCGTCGAACTCTGCATGGACATCATTCGCGAGGATAACCGGACGCACCTCGTGAAAACGCGCGAC
GGCGTGCCGACGCCCCGCGAAATCTGCAAGGTGCTGGACGATTACGTGATCGGGCAGGATCACGCCAAGCGGATTCTCAGTGTTGCCGTG
CACAACCACTACAAGCGGCTGGCGCACGCGCAGAAGAACAACGACATCGAGATCGCGAAGTCGAACATCATGCTGGTCGGGCCCACCGGC
TCGGGCAAGACGCTGCTCGCCCAGACGCTGGCCCGGATTCTCGACGTGCCGTTCACCATGGCGGACGCGACGACCCTGACCGAGGCGGGA
TATGTCGGCGAGGATGTCGAGAACATCATCCTCAAGCTGCTGCAGGCCGCGGATTACAATGTCGAGCGGGCGCAGCGCGGCATCGTCTAT
ATCGACGAGGTCGACAAGATCAGCCGCAAGTCCGACAACCCCTCAATCACGCGCGACGTATCCGGCGAGGGCGTGCAGCAGGCGCTGCTC
AAGATCATGGAAGGGACGGTGGCCTCGGTGCCGCCGCAGGGCGGGCGGAAGCATCCGCAACAGGAGTTCCTCCAGGTTGATACCACCAAC
ATCCTCTTCATCTGCGGCGGCGCCTTCGCCGGGCTGGAGAAGATCATCGCACAGCGTGGCAAGGGGTCGGGAATCGGCTTCGGCGCCGAT
GTGCGCGACCCGACGGAGCAGCGCACCGGCGCGATCCTGCGCGAAGTCGAGCCCGAGGATCTGCTGAAGTTCGGCCTGATCCCCGAATTC
ATTGGCCGTCTGCCCGTCGTTGCGACGCTCGAGGACCTCGACGAGGCGGCGCTGATCGAGATCCTCACCAAGCCGAAGAACGCGCTTGTG
AAGCAATACGGCCGCCTTTTCGAAATGGAGGGCGTGAAGCTCAACTTCACCGAAGACGCGCTGAAAGTGGTCGCCGCCCGTGCGATCCAG
CGCAAGACCGGGGCGCGTGGCCTGCGGTCGATCATGGAAAACATCCTGCTCGAGACGATGTTCGACCTCCCGGGCCTCGACTCGGTCGAA
GAGGTCGTGATCAACGGCGAAGTAGCCGAGGGGCGGGCAAATCCGCTTTTCCTGCATGGCAAGGAACGCGCTGAAACCGGCTCCTGA

Gene Information
Molecule Type genomic DNA
Bases 1257 Bases
Molecular Weight389106.55 Da
Coding Sequence CP000697.1:1019750..1021006
NCBI ReferenceABQ30137
NotesTIGRFAM: ATP-dependent Clp protease; ATP-binding

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
Zf_C4 11 to 50 40 C4_type Zinc finger domain PF06689
NBD_2 108 to 307 200 Nucleotide binding domain 2 PF07724
Clp_C 313 to 403 91 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpX_ACCR1

Accession Number

HSP100_0009

Added on

2012-02-02

Updated On

2014-01-20