Help  Custom Search
 
ATP-dependent Clp protease, ATP-binding subunit clpA. of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent Clp protease, ATP-binding subunit clpA.

Synonymous Names

A5G1K5_ACICJ, Caseinolytic peptidase A, ClpA.

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpA-Caseinolytic peptidase A)

SEQUENCE INFORMATION

Sequence
MLSRNLEQTLHRALGFAAERRHEYATLEHLLLGLIDDADALTVLRACGVDIERLRRETTEFLDKELAGLA TDRGGDPKPTAGFQRVVQRAAIHVQSSGRDEVTGANVLVALFSERESHAVYFLQAQDMTRLDAVNFISHG IAKSPGRSVPRPPSGSAEGTEAEPEQKPKRGQDALANYCVNLNKKAQSGKIDPLIGRETEIERTIQILCR RSKNNPLFVGDPGVGKTAIAEGLAKRIVDGEVPEVLAKATIYALDMGALLAGTRYRGDFEERLKAVVSEL EAMPGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGALRCIGSTTYKEFRSYFEKDRALVRRFQKI DVNEPSIDDAVKILRGLKTTYEKHHKVRYTDEAIRASVELSAKYIHDRKLPDKAIDVIDEVGASRMLLPE NKRRKTVTLRDVEEIVAKIARIPPKSVSADDKETLRTLERDLKSMVFGQDSAIEALSAAIKLARAGLRDA EKPIGCYLFSGPTGVGKTEVARQLASTLGIELTRFDMSEYMERHSISRLIGAPPGYVGFDQGGLLTDSVD QHPHCVLLLDEIEKAHPDLFNILLQVMDHGKLTDHNGKTVDFRNVILIMTTNAGAADMAKTAIGFGRDVR LGEDEEAIKRLFTPEFRNRLDAVIPFSGLTPEIVARVVEKFVMQLEAQLADRNVTIELSSAAKEFLAERG YDPLYGARPLARVIQEQIKKPLAEELLFGRLATGGGVKVTVRDGELAFDIAEAPKPALPKPDGDQEESAP PQEVD

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCTGTCTCGCAATCTTGAACAGACGCTGCACCGGGCCCTCGGCTTCGCCGCTGAGCGCCGGCATGAATATGCGACGCTGGAGCATCT
TCTGCTGGGCCTGATTGACGACGCCGATGCGTTGACGGTGCTGCGCGCCTGCGGTGTCGACATTGAGCGCCTGCGCCGCGAGACGACCGA
ATTCCTTGACAAGGAACTGGCCGGACTTGCCACCGACCGTGGCGGCGACCCGAAGCCGACCGCCGGGTTCCAGCGCGTCGTGCAGCGTGC
CGCGATCCACGTGCAGTCGTCCGGTCGGGACGAGGTGACCGGCGCCAATGTGTTGGTCGCGCTGTTCTCGGAGCGTGAGAGTCATGCCGT
TTACTTCCTGCAGGCGCAGGATATGACCCGGCTGGACGCCGTCAATTTCATCAGCCATGGAATCGCGAAGTCGCCCGGCCGCTCCGTGCC
GCGCCCCCCTTCGGGCAGCGCCGAGGGCACGGAGGCCGAACCCGAGCAGAAGCCGAAGCGCGGACAGGACGCACTGGCGAATTATTGCGT
CAATCTCAACAAGAAGGCGCAATCCGGCAAGATCGACCCGCTCATTGGCCGCGAAACCGAGATCGAGCGGACGATCCAGATTCTCTGCCG
TCGTTCGAAGAACAATCCGCTCTTCGTCGGCGATCCCGGCGTTGGCAAGACCGCGATCGCCGAGGGCTTGGCCAAGCGCATCGTCGACGG
CGAGGTCCCGGAAGTGCTGGCCAAGGCGACGATCTATGCGCTCGACATGGGGGCACTGCTCGCCGGGACACGGTATCGTGGCGATTTCGA
GGAACGGCTCAAGGCGGTCGTTTCCGAGCTTGAGGCCATGCCCGGAGCGGTGCTGTTCATCGACGAAATCCATACCGTTATCGGCGCCGG
TGCGACCTCCGGCGGCGCCATGGATGCCTCGAACCTGCTCAAACCGGCCCTCTCATCCGGCGCGCTGCGTTGCATTGGCTCGACGACCTA
CAAGGAATTCCGCTCCTATTTCGAGAAAGATCGCGCACTGGTGCGCCGGTTCCAGAAAATCGACGTGAACGAGCCCTCGATCGATGATGC
GGTAAAGATCCTGCGCGGCCTCAAGACGACCTACGAGAAGCATCACAAGGTCCGCTACACCGACGAGGCGATCCGCGCCTCGGTCGAGCT
TTCGGCGAAATACATCCACGACCGCAAACTGCCGGACAAGGCGATCGATGTGATCGATGAGGTTGGCGCCTCGCGGATGCTGCTGCCCGA
GAACAAGCGGCGCAAGACCGTCACGTTGCGCGATGTCGAGGAAATCGTTGCCAAGATCGCGCGGATTCCGCCCAAATCGGTTTCGGCCGA
CGACAAGGAGACGCTGCGCACGCTTGAGCGGGATCTCAAGTCGATGGTGTTTGGCCAGGATTCCGCGATTGAGGCGTTGTCCGCGGCGAT
CAAGCTGGCCCGTGCGGGACTGCGCGACGCCGAGAAGCCGATCGGCTGCTACCTCTTCTCCGGCCCCACAGGCGTCGGCAAGACCGAGGT
TGCCCGTCAGCTGGCCTCCACCCTGGGGATCGAGCTGACGCGGTTCGATATGTCGGAATACATGGAACGCCATTCGATCTCCCGCCTGAT
CGGTGCGCCGCCGGGCTATGTCGGGTTCGACCAGGGCGGCCTGCTGACCGATTCGGTCGACCAGCATCCGCACTGCGTGCTGCTGCTCGA
TGAGATTGAAAAGGCACATCCAGACCTGTTCAACATCCTGCTGCAGGTCATGGATCACGGCAAACTGACCGACCACAATGGCAAGACGGT
CGATTTCCGGAATGTGATCCTGATCATGACGACGAATGCGGGAGCGGCCGATATGGCGAAGACCGCGATCGGCTTCGGTCGTGATGTGCG
TCTCGGAGAAGACGAAGAGGCGATCAAGCGCCTCTTCACCCCGGAATTCCGCAACCGGCTCGACGCGGTCATTCCGTTCTCGGGGCTCAC
ACCGGAGATCGTCGCCCGAGTGGTCGAGAAGTTCGTCATGCAGCTTGAGGCACAGCTTGCGGATCGCAACGTGACGATCGAGCTTTCCTC
GGCCGCAAAGGAATTCCTCGCCGAGCGTGGTTACGATCCGCTTTACGGCGCGCGGCCACTGGCCCGTGTGATCCAGGAGCAGATCAAGAA
GCCGCTCGCCGAGGAGCTGCTGTTCGGCCGGCTGGCAACCGGCGGCGGCGTGAAGGTGACGGTTCGTGACGGTGAACTGGCTTTCGACAT
TGCCGAGGCACCCAAGCCCGCGCTTCCAAAGCCGGATGGCGACCAGGAAGAGTCGGCGCCGCCGCAGGAAGTCGACTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine45020 %
Guanine74633 %
Thyamine41118 %
Cytosine72131 %
A+T86137 %
G+C146764 %

Total Bases :   2328 bases

Microsatellites
SequencePosition LengthRepeats
GCGCGC13123
CCCCCC45223
GCGCGC95823
TGCTGCTGC124633
CGCGCG131623
TGCTGCTGC169633
GCGCGC211623
CGGCGGCGG219833
CGCCGCCGC230533

Microsatellite Map

ATGCTGTCTCGCAATCTTGAACAGACGCTGCACCGGGCCCTCGGCTTCGCCGCTGAGCGCCGGCATGAATATGCGACGCTGGAGCATCTT
CTGCTGGGCCTGATTGACGACGCCGATGCGTTGACGGTGCTGCGCGCCTGCGGTGTCGACATTGAGCGCCTGCGCCGCGAGACGACCGAA
TTCCTTGACAAGGAACTGGCCGGACTTGCCACCGACCGTGGCGGCGACCCGAAGCCGACCGCCGGGTTCCAGCGCGTCGTGCAGCGTGCC
GCGATCCACGTGCAGTCGTCCGGTCGGGACGAGGTGACCGGCGCCAATGTGTTGGTCGCGCTGTTCTCGGAGCGTGAGAGTCATGCCGTT
TACTTCCTGCAGGCGCAGGATATGACCCGGCTGGACGCCGTCAATTTCATCAGCCATGGAATCGCGAAGTCGCCCGGCCGCTCCGTGCCG
CGCCCCCCTTCGGGCAGCGCCGAGGGCACGGAGGCCGAACCCGAGCAGAAGCCGAAGCGCGGACAGGACGCACTGGCGAATTATTGCGTC
AATCTCAACAAGAAGGCGCAATCCGGCAAGATCGACCCGCTCATTGGCCGCGAAACCGAGATCGAGCGGACGATCCAGATTCTCTGCCGT
CGTTCGAAGAACAATCCGCTCTTCGTCGGCGATCCCGGCGTTGGCAAGACCGCGATCGCCGAGGGCTTGGCCAAGCGCATCGTCGACGGC
GAGGTCCCGGAAGTGCTGGCCAAGGCGACGATCTATGCGCTCGACATGGGGGCACTGCTCGCCGGGACACGGTATCGTGGCGATTTCGAG
GAACGGCTCAAGGCGGTCGTTTCCGAGCTTGAGGCCATGCCCGGAGCGGTGCTGTTCATCGACGAAATCCATACCGTTATCGGCGCCGGT
GCGACCTCCGGCGGCGCCATGGATGCCTCGAACCTGCTCAAACCGGCCCTCTCATCCGGCGCGCTGCGTTGCATTGGCTCGACGACCTAC
AAGGAATTCCGCTCCTATTTCGAGAAAGATCGCGCACTGGTGCGCCGGTTCCAGAAAATCGACGTGAACGAGCCCTCGATCGATGATGCG
GTAAAGATCCTGCGCGGCCTCAAGACGACCTACGAGAAGCATCACAAGGTCCGCTACACCGACGAGGCGATCCGCGCCTCGGTCGAGCTT
TCGGCGAAATACATCCACGACCGCAAACTGCCGGACAAGGCGATCGATGTGATCGATGAGGTTGGCGCCTCGCGGATGCTGCTGCCCGAG
AACAAGCGGCGCAAGACCGTCACGTTGCGCGATGTCGAGGAAATCGTTGCCAAGATCGCGCGGATTCCGCCCAAATCGGTTTCGGCCGAC
GACAAGGAGACGCTGCGCACGCTTGAGCGGGATCTCAAGTCGATGGTGTTTGGCCAGGATTCCGCGATTGAGGCGTTGTCCGCGGCGATC
AAGCTGGCCCGTGCGGGACTGCGCGACGCCGAGAAGCCGATCGGCTGCTACCTCTTCTCCGGCCCCACAGGCGTCGGCAAGACCGAGGTT
GCCCGTCAGCTGGCCTCCACCCTGGGGATCGAGCTGACGCGGTTCGATATGTCGGAATACATGGAACGCCATTCGATCTCCCGCCTGATC
GGTGCGCCGCCGGGCTATGTCGGGTTCGACCAGGGCGGCCTGCTGACCGATTCGGTCGACCAGCATCCGCACTGCGTGCTGCTGCTCGAT
GAGATTGAAAAGGCACATCCAGACCTGTTCAACATCCTGCTGCAGGTCATGGATCACGGCAAACTGACCGACCACAATGGCAAGACGGTC
GATTTCCGGAATGTGATCCTGATCATGACGACGAATGCGGGAGCGGCCGATATGGCGAAGACCGCGATCGGCTTCGGTCGTGATGTGCGT
CTCGGAGAAGACGAAGAGGCGATCAAGCGCCTCTTCACCCCGGAATTCCGCAACCGGCTCGACGCGGTCATTCCGTTCTCGGGGCTCACA
CCGGAGATCGTCGCCCGAGTGGTCGAGAAGTTCGTCATGCAGCTTGAGGCACAGCTTGCGGATCGCAACGTGACGATCGAGCTTTCCTCG
GCCGCAAAGGAATTCCTCGCCGAGCGTGGTTACGATCCGCTTTACGGCGCGCGGCCACTGGCCCGTGTGATCCAGGAGCAGATCAAGAAG
CCGCTCGCCGAGGAGCTGCTGTTCGGCCGGCTGGCAACCGGCGGCGGCGTGAAGGTGACGGTTCGTGACGGTGAACTGGCTTTCGACATT
GCCGAGGCACCCAAGCCCGCGCTTCCAAAGCCGGATGGCGACCAGGAAGAGTCGGCGCCGCCGCAGGAAGTCGACTGA

Gene Information
Molecule Type genomic DNA
Bases 2328 Bases
Molecular Weight719998.18 Da
Coding Sequence CP000697.1:2797818..2800145
NCBI ReferenceABQ31737
NotesTIGRFAM: ATP-dependent Clp protease; ATP-binding

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 13 to 63 51 Clp amino terminal domain PF02861
NBD_1 216 to 353 138 Nucleotide binding domain 1 PF00004
NBD_2 492 to 653 162 Nucleotide binding domain 2 PF07724
Clp_C 659 to 748 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpA_ACCR1

Accession Number

HSP100_0008

Added on

2012-02-02

Updated On

2014-01-20