Help  Custom Search
 
ATPase AAA-2 domain protein of Acidiphilium cryptum str. JF-5

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATPase AAA-2 domain protein

Synonymous Names

A5FZJ3_ACICJ, Caseinolytic peptidase B, ClpB.

Taxon Information

Organism

Acidiphilium cryptum str. JF-5

Organism ID

349163 [NCBI] [UNIPROT]

Lineage

Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Acetobacteraceae; Acidiphilium; Acidiphilium cryptum JF-5

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MDFEKFTERARGFVQAAQTIAVREYHQQITPEHLLKAFLDDEEGAASGLIRAAGGDPAAVRLAADAAIGK LPKVQGSGAGQPQITPDLVRVLDAAQQMAQKAGDEYVAQDRVLVALAASGTPAGRALTAAGASAQALEKA VADIRKGRTVTSANAEQTFDALKKYARDVTEAARAQKLDPVIGRDEEIRRAIQVLARRTKNNPVLIGEPG VGKTAIVEGLALRIVNGDVPEALKGKRLLALDLGAMVAGAKYRGEFEERLKAVLKEIEGSNGEVILFIDE MHTLVGAGRADGAMDASNLIKPELARGALHCVGATTLDEYRKYIEKDAALARRFQPVFVDEPSVEDTISI LRGIKEKYELHHGVRISDSALVAAATLSNRYITDRFLPDKAIDLVDEAASRLRMQVDSKPEALDELDRRL MQLKIEREALRKEQDPASKERLERLEGEIAELEEKSDAMTAAWKAEKDRLNATQKLKEQLDQARGEAEMA QRSGNLTRASELMYGVIPEIERKLAAGPTEGAMVNEAVTEAQIAQVVARWTGIPVDRMLEGERAKLIRME EELRKRVVGQEAALRAVSDAVRRARAGLQDPNRPIGSFLFLGPTGVGKTETCKALAEFLFDDERAMVRID MSEFMEKHAVARLIGAPPGYVGYEEGGVLTEAVRRRPYQVILFDEVEKAHEDVFNVLLQVLDDGRLTDGQ GRTVDFKNTIIVLTSNLGSEVLAAQPEGEDVVLAEPQVMRVVRQHFRPEFLNRLDEIILFRRLQRADMAR IVEIQLRHLESLLADRKITLHLDQAARDWLANEGYDPVYGARPLKRVIQRSLQNKLATRLLEGAIHDGET VNVTIDDDGLSIAGGLAAAA

FASTA Format Composition Secondary Structure

Nucleotide
 ATGGATTTCGAGAAGTTTACCGAACGCGCCCGCGGCTTCGTGCAGGCCGCGCAGACGATTGCCGTGCGCGAATATCACCAGCAGATCAC
GCCGGAACACCTGCTCAAGGCGTTTCTCGACGATGAGGAAGGGGCCGCGAGCGGGCTGATCCGCGCGGCCGGGGGCGATCCGGCCGCGGT
TCGTCTCGCGGCCGATGCCGCGATTGGAAAACTGCCGAAGGTGCAGGGCTCCGGCGCCGGGCAGCCGCAGATCACGCCCGATCTCGTGCG
GGTGCTCGATGCGGCGCAGCAGATGGCGCAGAAGGCCGGCGATGAATATGTCGCGCAGGACCGCGTGCTGGTGGCACTCGCGGCGAGCGG
CACGCCGGCGGGCCGGGCGCTGACCGCGGCCGGCGCCTCGGCGCAGGCCCTGGAGAAGGCGGTGGCCGATATCCGCAAGGGCCGCACGGT
GACGAGCGCGAACGCGGAGCAGACCTTCGATGCGCTGAAGAAATATGCGCGGGATGTGACCGAGGCCGCGCGCGCGCAGAAGCTTGATCC
GGTGATCGGCCGCGACGAGGAGATCCGCCGGGCGATCCAGGTGCTGGCGCGGCGGACCAAGAACAACCCGGTGCTCATCGGCGAGCCTGG
GGTTGGCAAGACGGCGATCGTCGAGGGGCTCGCGCTCCGCATCGTCAATGGCGACGTGCCGGAGGCGCTGAAGGGCAAGCGGCTGCTCGC
GCTCGATCTCGGCGCGATGGTGGCCGGCGCGAAATATCGCGGCGAGTTCGAGGAACGGCTGAAAGCCGTGCTGAAGGAGATCGAAGGCTC
GAACGGCGAGGTCATCCTGTTCATCGACGAGATGCACACGCTGGTCGGCGCGGGGCGGGCGGATGGCGCGATGGATGCCTCGAACCTGAT
CAAGCCCGAACTGGCTCGCGGCGCGCTGCACTGCGTGGGGGCGACGACGCTCGACGAGTATCGGAAGTACATCGAGAAGGATGCGGCGCT
GGCGCGGCGCTTCCAGCCGGTCTTCGTGGATGAGCCGAGTGTCGAGGACACGATCTCGATCCTGCGCGGGATCAAGGAGAAATACGAACT
TCATCACGGCGTGCGGATTTCGGATTCGGCGCTGGTGGCGGCGGCGACCCTGTCCAACCGCTACATTACTGACCGGTTCCTGCCGGACAA
GGCGATCGACCTTGTCGACGAGGCCGCCTCGCGCCTGCGGATGCAGGTGGATTCCAAGCCCGAGGCGCTCGATGAACTCGATCGGCGGCT
GATGCAGCTCAAGATCGAACGGGAAGCGCTGCGCAAGGAGCAGGATCCCGCCTCGAAGGAACGGCTGGAGCGGCTGGAGGGTGAAATCGC
CGAACTCGAGGAGAAATCCGACGCGATGACGGCGGCGTGGAAGGCCGAAAAGGACCGACTGAATGCCACGCAAAAGCTGAAGGAGCAGCT
CGATCAGGCGCGGGGCGAGGCGGAGATGGCGCAGCGCTCCGGCAATCTGACCCGGGCCTCGGAGCTGATGTATGGCGTGATCCCCGAGAT
CGAGCGGAAGCTCGCCGCCGGGCCGACGGAAGGAGCCATGGTCAACGAGGCGGTCACCGAAGCGCAGATCGCCCAGGTGGTGGCCCGCTG
GACCGGCATTCCGGTCGACCGGATGCTGGAGGGCGAGCGCGCCAAGCTCATCAGGATGGAAGAGGAGTTGCGCAAGCGCGTGGTGGGCCA
GGAAGCCGCGCTGCGGGCGGTTTCGGATGCCGTGCGCCGGGCACGGGCCGGGTTGCAGGATCCGAACCGACCGATCGGCTCCTTCCTGTT
CCTGGGCCCGACCGGCGTCGGCAAGACCGAAACCTGCAAGGCGCTGGCCGAGTTTCTGTTCGACGATGAGCGGGCGATGGTGCGCATCGA
CATGAGCGAATTCATGGAGAAGCACGCCGTGGCCCGGCTGATCGGCGCGCCGCCAGGCTATGTCGGCTACGAGGAAGGCGGGGTGCTCAC
CGAAGCCGTGCGGCGCCGGCCGTATCAGGTGATCCTATTCGACGAGGTCGAGAAGGCGCACGAGGATGTCTTCAACGTCTTGTTGCAGGT
GCTTGATGATGGCCGACTGACCGACGGACAGGGGCGCACGGTCGACTTCAAGAACACGATCATCGTGCTCACGTCGAACCTGGGCAGCGA
GGTGCTCGCCGCTCAGCCTGAAGGCGAGGATGTCGTATTGGCCGAACCGCAGGTGATGCGGGTGGTCCGCCAGCATTTCCGGCCGGAATT
CCTGAACCGGCTGGACGAGATCATCCTGTTCCGGCGCCTGCAGCGCGCCGATATGGCACGGATCGTCGAAATTCAGTTGAGGCATCTGGA
ATCGCTTCTCGCAGACCGGAAGATCACCCTGCATCTCGATCAGGCGGCGCGGGACTGGCTGGCGAACGAGGGATACGACCCGGTCTACGG
GGCACGGCCGCTGAAGCGGGTGATTCAGCGTTCGCTGCAGAACAAGCTGGCGACGAGGCTCCTCGAAGGGGCCATCCATGACGGCGAGAC
GGTGAATGTGACCATCGACGATGACGGTCTCTCGATTGCCGGCGGGCTCGCGGCGGCAGCCTGA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine48619 %
Guanine96038 %
Thyamine38515 %
Cytosine75230 %
A+T87134 %
G+C171267 %

Total Bases :   2583 bases

Microsatellites
SequencePosition LengthRepeats
CGCGCG15023
CGCGCGCGCG51525
GCGCGC91923
GGCGGCGGC111533
GCGCGC165523
GCGCGC193323
GCGCGC229123
TCTCTC254623

Microsatellite Map

ATGGATTTCGAGAAGTTTACCGAACGCGCCCGCGGCTTCGTGCAGGCCGCGCAGACGATTGCCGTGCGCGAATATCACCAGCAGATCACG
CCGGAACACCTGCTCAAGGCGTTTCTCGACGATGAGGAAGGGGCCGCGAGCGGGCTGATCCGCGCGGCCGGGGGCGATCCGGCCGCGGTT
CGTCTCGCGGCCGATGCCGCGATTGGAAAACTGCCGAAGGTGCAGGGCTCCGGCGCCGGGCAGCCGCAGATCACGCCCGATCTCGTGCGG
GTGCTCGATGCGGCGCAGCAGATGGCGCAGAAGGCCGGCGATGAATATGTCGCGCAGGACCGCGTGCTGGTGGCACTCGCGGCGAGCGGC
ACGCCGGCGGGCCGGGCGCTGACCGCGGCCGGCGCCTCGGCGCAGGCCCTGGAGAAGGCGGTGGCCGATATCCGCAAGGGCCGCACGGTG
ACGAGCGCGAACGCGGAGCAGACCTTCGATGCGCTGAAGAAATATGCGCGGGATGTGACCGAGGCCGCGCGCGCGCAGAAGCTTGATCCG
GTGATCGGCCGCGACGAGGAGATCCGCCGGGCGATCCAGGTGCTGGCGCGGCGGACCAAGAACAACCCGGTGCTCATCGGCGAGCCTGGG
GTTGGCAAGACGGCGATCGTCGAGGGGCTCGCGCTCCGCATCGTCAATGGCGACGTGCCGGAGGCGCTGAAGGGCAAGCGGCTGCTCGCG
CTCGATCTCGGCGCGATGGTGGCCGGCGCGAAATATCGCGGCGAGTTCGAGGAACGGCTGAAAGCCGTGCTGAAGGAGATCGAAGGCTCG
AACGGCGAGGTCATCCTGTTCATCGACGAGATGCACACGCTGGTCGGCGCGGGGCGGGCGGATGGCGCGATGGATGCCTCGAACCTGATC
AAGCCCGAACTGGCTCGCGGCGCGCTGCACTGCGTGGGGGCGACGACGCTCGACGAGTATCGGAAGTACATCGAGAAGGATGCGGCGCTG
GCGCGGCGCTTCCAGCCGGTCTTCGTGGATGAGCCGAGTGTCGAGGACACGATCTCGATCCTGCGCGGGATCAAGGAGAAATACGAACTT
CATCACGGCGTGCGGATTTCGGATTCGGCGCTGGTGGCGGCGGCGACCCTGTCCAACCGCTACATTACTGACCGGTTCCTGCCGGACAAG
GCGATCGACCTTGTCGACGAGGCCGCCTCGCGCCTGCGGATGCAGGTGGATTCCAAGCCCGAGGCGCTCGATGAACTCGATCGGCGGCTG
ATGCAGCTCAAGATCGAACGGGAAGCGCTGCGCAAGGAGCAGGATCCCGCCTCGAAGGAACGGCTGGAGCGGCTGGAGGGTGAAATCGCC
GAACTCGAGGAGAAATCCGACGCGATGACGGCGGCGTGGAAGGCCGAAAAGGACCGACTGAATGCCACGCAAAAGCTGAAGGAGCAGCTC
GATCAGGCGCGGGGCGAGGCGGAGATGGCGCAGCGCTCCGGCAATCTGACCCGGGCCTCGGAGCTGATGTATGGCGTGATCCCCGAGATC
GAGCGGAAGCTCGCCGCCGGGCCGACGGAAGGAGCCATGGTCAACGAGGCGGTCACCGAAGCGCAGATCGCCCAGGTGGTGGCCCGCTGG
ACCGGCATTCCGGTCGACCGGATGCTGGAGGGCGAGCGCGCCAAGCTCATCAGGATGGAAGAGGAGTTGCGCAAGCGCGTGGTGGGCCAG
GAAGCCGCGCTGCGGGCGGTTTCGGATGCCGTGCGCCGGGCACGGGCCGGGTTGCAGGATCCGAACCGACCGATCGGCTCCTTCCTGTTC
CTGGGCCCGACCGGCGTCGGCAAGACCGAAACCTGCAAGGCGCTGGCCGAGTTTCTGTTCGACGATGAGCGGGCGATGGTGCGCATCGAC
ATGAGCGAATTCATGGAGAAGCACGCCGTGGCCCGGCTGATCGGCGCGCCGCCAGGCTATGTCGGCTACGAGGAAGGCGGGGTGCTCACC
GAAGCCGTGCGGCGCCGGCCGTATCAGGTGATCCTATTCGACGAGGTCGAGAAGGCGCACGAGGATGTCTTCAACGTCTTGTTGCAGGTG
CTTGATGATGGCCGACTGACCGACGGACAGGGGCGCACGGTCGACTTCAAGAACACGATCATCGTGCTCACGTCGAACCTGGGCAGCGAG
GTGCTCGCCGCTCAGCCTGAAGGCGAGGATGTCGTATTGGCCGAACCGCAGGTGATGCGGGTGGTCCGCCAGCATTTCCGGCCGGAATTC
CTGAACCGGCTGGACGAGATCATCCTGTTCCGGCGCCTGCAGCGCGCCGATATGGCACGGATCGTCGAAATTCAGTTGAGGCATCTGGAA
TCGCTTCTCGCAGACCGGAAGATCACCCTGCATCTCGATCAGGCGGCGCGGGACTGGCTGGCGAACGAGGGATACGACCCGGTCTACGGG
GCACGGCCGCTGAAGCGGGTGATTCAGCGTTCGCTGCAGAACAAGCTGGCGACGAGGCTCCTCGAAGGGGCCATCCATGACGGCGAGACG
GTGAATGTGACCATCGACGATGACGGTCTCTCGATTGCCGGCGGGCTCGCGGCGGCAGCCTGA

Gene Information
Molecule Type genomic DNA
Bases 2583 Bases
Molecular Weight802780.06 Da
Coding Sequence complement(CP000697.1:2013473..2016055)
NCBI ReferenceABQ31025
NotesPFAM: AAA ATPase; central domain protein; Clp N

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
N Domain 17 to 69 53 Clp amino terminal domain PF02861
N Domain 94 to 146 52 Clp amino terminal domain PF02861
NBD_1 203 to 339 137 Nucleotide binding domain 1 PF00004
M Domain 410 to 475 66 Coiled coil Middle domain Manually identified
M Domain 547 to 569 23 Coiled coil Middle domain Manually identified
NBD_2 593 to 757 165 Nucleotide binding domain 2 PF07724
Clp_C 763 to 852 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACCR1

Accession Number

HSP100_0006

Added on

2012-02-02

Updated On

2014-01-20