Help  Custom Search
 
ATP-dependent Clp protease, ATP-binding subunit of Acholeplasma laidlawii str. PG-8A

 Names & Lineage - Classification - Sequence - Domains - Ontologies - Refernces - X-Ref - External Links -Record Info 

NAMES AND LINEAGE

Protein names

Name

ATP-dependent Clp protease, ATP-binding subunit

Synonymous Names

A9NHA3_ACHLI, Caseinolytic peptidase B, ClpB.

Gene names

Gene Name

clpB

Gene Locus Tag

ACL_1124

Gene Identifier

5803793

Taxon Information

Organism

Acholeplasma laidlawii str. PG-8A

Organism ID

441768 [NCBI] [UNIPROT]

Lineage

Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Acholeplasma; Acholeplasma laidlawii PG-8A

CLASSIFICATION

Protein Classification

Protein Family

Belongs to Hsp100 Protein family

Protein Type

Class I Clp Proteins
(ClpB-Caseinolytic peptidase B)

SEQUENCE INFORMATION

Sequence
MQFNPMDDYSKDPDILKKFGRNIVELVKEGKVDPVIGREEEIRRIIKILSRKTKNNPVLIGEPGVGKTAI VEGLARRIVDKDVPLSLQNKIVYELDLAQLVAGAKFRGEFEERLKDVLNKIKESDGQIILFIDELHNIVG AGRADGAMDASNILKPMLARGELHCIGATTLNEYRLYIEKDSALERRFQKITVTEPTMEDTISILRGLKD RFEAHHGVHISDGAIIAATNLSARYITDRFLPDKAIDLIDEACASIRMEIDSMPVELDDVQRKILQLEIE KSALSKETDTLSKERLSKIKSEIDDLKLEEASLKSRWEKEKSQLNLSKRKKETLEQLKNELNTAYNEGNY SKAAELQYSKIPNLEKEISELSDTSTDDKLLTETVTPESIAEIVSKWTHIPVTKLVSGDREKLRNLRLSL GKRVLGQDHALELISNAILRHRAGIKDPNRPIGSFLFLGPTGVGKTEAAKALAENLFDSENHIVRIDMSE YMESHSVSRLIGAPPGYVGYDQGGQLTEKIRRMPYAIVLFDEIEKAHPEVFNILLQVLDDGHLTDGQGRT IDFKNTVIIMTSNIGSQYLLENASDAQEKIDKLLKQSFKPEFLNRIDEIITFNSLGFKVQVDITRKLLNE LSEKLKEENIYITLGEDVQKYVIKNGFNEQFGARPLKRYIQRDIETFIAKAIISEDVLPNHHYEVIVDND TLNIKLVS

FASTA Format Composition Secondary Structure

Nucleotide
 ATGCAATTTAACCCAATGGATGATTATTCAAAAGATCCTGACATTTTAAAAAAGTTCGGTAGAAATATTGTAGAACTTGTTAAAGAAGG
TAAAGTCGACCCAGTGATTGGTCGTGAGGAAGAGATTAGACGTATTATTAAAATTCTATCTAGAAAAACCAAAAACAACCCTGTTTTAAT
TGGTGAACCGGGGGTGGGTAAAACAGCGATTGTTGAAGGCTTAGCTAGAAGAATTGTTGATAAAGACGTACCTTTAAGTCTGCAAAATAA
AATTGTTTATGAACTAGACTTAGCTCAATTAGTTGCTGGTGCAAAATTTAGAGGTGAGTTTGAAGAACGTTTGAAGGATGTTTTAAATAA
GATTAAAGAAAGCGATGGCCAAATCATCTTATTTATTGATGAATTACATAATATTGTAGGTGCTGGTCGTGCAGATGGTGCAATGGATGC
CTCAAACATCTTAAAACCAATGCTTGCACGTGGTGAACTTCACTGTATTGGTGCTACAACATTAAATGAATACCGCTTATATATTGAAAA
AGATAGTGCACTCGAAAGAAGATTTCAAAAGATCACTGTGACTGAACCAACTATGGAAGATACAATTTCTATCTTACGTGGACTTAAAGA
TCGATTTGAAGCACATCATGGTGTGCACATCTCTGATGGTGCCATCATCGCTGCTACAAATCTATCAGCACGTTACATTACAGATAGATT
CTTACCAGATAAAGCAATCGACCTTATTGATGAGGCTTGTGCTTCTATTCGTATGGAAATTGATTCTATGCCAGTGGAACTTGATGATGT
TCAAAGAAAAATACTACAACTAGAAATTGAAAAATCTGCTTTAAGTAAAGAAACAGATACATTAAGTAAAGAGCGTCTATCTAAAATTAA
ATCTGAGATTGATGATTTAAAATTAGAGGAAGCCAGTCTAAAAAGTAGATGGGAAAAAGAAAAATCTCAACTTAATTTATCAAAACGCAA
AAAAGAAACCTTGGAACAACTTAAAAACGAACTTAATACTGCTTATAACGAAGGTAACTATTCTAAGGCTGCAGAACTTCAATACTCAAA
AATACCTAATCTAGAAAAAGAAATATCTGAATTATCAGATACTTCAACAGATGATAAACTTCTAACAGAAACTGTTACCCCTGAATCGAT
TGCTGAAATCGTAAGTAAATGGACCCATATACCTGTAACAAAACTAGTATCAGGTGATAGAGAAAAACTTAGAAACCTACGTTTAAGCCT
AGGTAAACGTGTATTAGGTCAAGATCATGCACTAGAACTGATTAGTAACGCCATATTACGTCATCGTGCAGGTATCAAAGATCCAAATAG
ACCAATTGGTTCATTCTTATTCTTAGGTCCGACTGGTGTTGGTAAAACAGAGGCTGCTAAAGCACTTGCTGAAAATTTATTTGACTCAGA
AAATCATATTGTTCGTATAGATATGTCAGAGTATATGGAATCACATAGTGTCTCTCGTTTAATCGGCGCACCTCCAGGATATGTAGGTTA
TGATCAAGGCGGTCAACTTACAGAAAAAATAAGACGTATGCCTTACGCAATCGTCTTATTTGATGAAATTGAAAAGGCACATCCTGAAGT
CTTTAATATCCTACTTCAAGTATTAGATGATGGTCACTTAACAGATGGACAAGGTCGTACAATAGATTTTAAAAATACTGTCATTATTAT
GACATCTAACATTGGCAGTCAATATTTACTAGAAAACGCAAGTGATGCCCAAGAAAAAATAGATAAACTGCTAAAACAATCCTTTAAACC
AGAATTTTTAAATAGAATTGATGAAATTATTACATTTAACTCACTTGGATTTAAAGTTCAAGTGGATATCACAAGAAAACTACTCAATGA
ACTTTCAGAAAAATTAAAAGAAGAAAACATCTACATTACATTGGGTGAAGATGTTCAAAAATACGTTATCAAAAACGGATTTAATGAACA
ATTTGGTGCAAGACCACTTAAACGTTATATCCAAAGAGACATAGAAACATTTATCGCAAAAGCAATCATTTCAGAAGATGTACTGCCAAA
TCATCACTATGAAGTTATTGTAGACAATGATACATTAAACATTAAATTAGTCTCATAA 

Download Fasta Sequence

Composition
NucleotideCountPercentage
Adenine80838 %
Guanine37918 %
Thyamine60729 %
Cytosine33316 %
A+T141567 %
G+C71234 %

Total Bases :   2127 bases

Microsatellites
SequencePosition LengthRepeats
AAAAAA4723
TATATA52623
AAAAAA98723
TCTCTC148923
AAAAAA155223
AAAAAA176223

Microsatellite Map

ATGCAATTTAACCCAATGGATGATTATTCAAAAGATCCTGACATTTTAAAAAAGTTCGGTAGAAATATTGTAGAACTTGTTAAAGAAGGT
AAAGTCGACCCAGTGATTGGTCGTGAGGAAGAGATTAGACGTATTATTAAAATTCTATCTAGAAAAACCAAAAACAACCCTGTTTTAATT
GGTGAACCGGGGGTGGGTAAAACAGCGATTGTTGAAGGCTTAGCTAGAAGAATTGTTGATAAAGACGTACCTTTAAGTCTGCAAAATAAA
ATTGTTTATGAACTAGACTTAGCTCAATTAGTTGCTGGTGCAAAATTTAGAGGTGAGTTTGAAGAACGTTTGAAGGATGTTTTAAATAAG
ATTAAAGAAAGCGATGGCCAAATCATCTTATTTATTGATGAATTACATAATATTGTAGGTGCTGGTCGTGCAGATGGTGCAATGGATGCC
TCAAACATCTTAAAACCAATGCTTGCACGTGGTGAACTTCACTGTATTGGTGCTACAACATTAAATGAATACCGCTTATATATTGAAAAA
GATAGTGCACTCGAAAGAAGATTTCAAAAGATCACTGTGACTGAACCAACTATGGAAGATACAATTTCTATCTTACGTGGACTTAAAGAT
CGATTTGAAGCACATCATGGTGTGCACATCTCTGATGGTGCCATCATCGCTGCTACAAATCTATCAGCACGTTACATTACAGATAGATTC
TTACCAGATAAAGCAATCGACCTTATTGATGAGGCTTGTGCTTCTATTCGTATGGAAATTGATTCTATGCCAGTGGAACTTGATGATGTT
CAAAGAAAAATACTACAACTAGAAATTGAAAAATCTGCTTTAAGTAAAGAAACAGATACATTAAGTAAAGAGCGTCTATCTAAAATTAAA
TCTGAGATTGATGATTTAAAATTAGAGGAAGCCAGTCTAAAAAGTAGATGGGAAAAAGAAAAATCTCAACTTAATTTATCAAAACGCAAA
AAAGAAACCTTGGAACAACTTAAAAACGAACTTAATACTGCTTATAACGAAGGTAACTATTCTAAGGCTGCAGAACTTCAATACTCAAAA
ATACCTAATCTAGAAAAAGAAATATCTGAATTATCAGATACTTCAACAGATGATAAACTTCTAACAGAAACTGTTACCCCTGAATCGATT
GCTGAAATCGTAAGTAAATGGACCCATATACCTGTAACAAAACTAGTATCAGGTGATAGAGAAAAACTTAGAAACCTACGTTTAAGCCTA
GGTAAACGTGTATTAGGTCAAGATCATGCACTAGAACTGATTAGTAACGCCATATTACGTCATCGTGCAGGTATCAAAGATCCAAATAGA
CCAATTGGTTCATTCTTATTCTTAGGTCCGACTGGTGTTGGTAAAACAGAGGCTGCTAAAGCACTTGCTGAAAATTTATTTGACTCAGAA
AATCATATTGTTCGTATAGATATGTCAGAGTATATGGAATCACATAGTGTCTCTCGTTTAATCGGCGCACCTCCAGGATATGTAGGTTAT
GATCAAGGCGGTCAACTTACAGAAAAAATAAGACGTATGCCTTACGCAATCGTCTTATTTGATGAAATTGAAAAGGCACATCCTGAAGTC
TTTAATATCCTACTTCAAGTATTAGATGATGGTCACTTAACAGATGGACAAGGTCGTACAATAGATTTTAAAAATACTGTCATTATTATG
ACATCTAACATTGGCAGTCAATATTTACTAGAAAACGCAAGTGATGCCCAAGAAAAAATAGATAAACTGCTAAAACAATCCTTTAAACCA
GAATTTTTAAATAGAATTGATGAAATTATTACATTTAACTCACTTGGATTTAAAGTTCAAGTGGATATCACAAGAAAACTACTCAATGAA
CTTTCAGAAAAATTAAAAGAAGAAAACATCTACATTACATTGGGTGAAGATGTTCAAAAATACGTTATCAAAAACGGATTTAATGAACAA
TTTGGTGCAAGACCACTTAAACGTTATATCCAAAGAGACATAGAAACATTTATCGCAAAAGCAATCATTTCAGAAGATGTACTGCCAAAT
CATCACTATGAAGTTATTGTAGACAATGATACATTAAACATTAAATTAGTCTCATAA

Gene Information
Molecule Type genomic DNA
Bases 2127 Bases
Molecular Weight658728.65 Da
Coding Sequence CP000896.1:1186761..1188887
NCBI ReferenceABX81733
Notes

DOMAINS AND MOTIFS   Hide

Domains
Domain Position Length Description Feature Identifier
NBD_1 57 to 231 175 Nucleotide binding domain 1 PF00004
M Domain 265 to 349 85 Coiled coil Middle domain Manually identified
NBD_2 450 to 609 160 Nucleotide binding domain 2 PF07724
Clp_C 615 to 704 90 C terminal, D2 small domain PF10431

Graphical View

ONTOLOGIES   Show


LITERATURE REFERENCES   Show


ACCESSIONS   Show


OTHER LINKS   Show



Protein Card Information

Record Information

Entry Name

ClpB_ACLA1

Accession Number

HSP100_0005

Added on

2012-02-02

Updated On

2014-01-20